The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDG
SEGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITD
SCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMNVAFKVDA
GSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFS
IRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72986 Ory s 1 275 1896 356.7 5.2e-100
AAA50175 Gly m 2 277 954 184.5 3.5e-48
AAF72988 Ory s 1 327 848 165.2 2.8e-42
AAF72987 Ory s 1 275 837 163.2 9.4e-42
AAF72984 Ory s 1 268 818 159.7 1e-40
AAF72989 Ory s 1 271 797 155.9 1.5e-39
AAD10496 Tri a ps93 271 786 153.8 5.9e-39
AAF72985 Ory s 1 286 785 153.7 7.1e-39
AAB61710 Ory s 1 261 761 149.3 1.3e-37
A0A4D6G2J8 Uro m 1.0201 229 755 148.2 2.5e-37
AAF72991 Ory s 1 267 755 148.2 2.9e-37
AAF72983 Ory s 1 267 754 148.0 3.3e-37
P43213 Phl p 1 263 742 145.8 1.5e-36
CAA10140 Hol l 1 263 726 142.9 1.1e-35
CAA81613 Phl p 1.0101 263 723 142.3 1.7e-35
CAA10520 Poa p a 263 720 141.8 2.4e-35
ACA23876 Pas n 1.0101 265 718 141.4 3.2e-35
AAF72990 Ory s 1 269 717 141.2 3.7e-35
P58738 Zea m 1 269 714 140.7 5.3e-35
P43216 Hol l 1 265 713 140.5 6e-35
CAA93121 Hol l 1.0102 248 710 140.0 8.1e-35
AAL14079 Cyn d 1.0203 262 707 139.4 1.3e-34
A0A4D6FZ45 Uro m 1.0101 262 707 139.4 1.3e-34
AAA63278 Lol p 1.0102 252 704 138.9 1.8e-34
CAB63699 Lol p 1.0103 263 703 138.7 2.1e-34
AAA63279 Lol p 1.0101 263 696 137.4 5.1e-34
AAL14077 Cyn d 1.0202 262 694 137.0 6.5e-34
P14946 Lol p 1 263 694 137.0 6.6e-34
O04701 Cyn d 1 246 689 136.1 1.2e-33
AAF80379 Cyn d 1.0204 244 688 136.0 1.3e-33
AAK96255 Cyn d 1.0201 244 687 135.8 1.5e-33
Q41260 Pha a 1 269 686 135.6 1.9e-33
AAL14078 Cyn d 1 262 679 134.3 4.4e-33
QCX36431 Zoy m 1.0101 272 677 133.9 5.9e-33
ABC58726 Sor h 1.0101 239 665 131.8 2.3e-32
Q07154 Zea m 1 191 594 118.8 1.5e-28
Q40638 Ory s 1 263 585 117.1 6.5e-28
CAB37496 Ara t expansin 265 432 89.2 1.7e-19
BAA85432 Ory s 1 284 420 87.0 8.5e-19
AAG13596 Ory s 1 275 407 84.6 4.2e-18
P14947 Lol p 2 97 195 46.0 6.3e-07
CAA10345 Dac g 2 122 191 45.2 1.3e-06
CAA10348 Poa p 2 122 191 45.2 1.3e-06
CAA10346 Cyn d 2 122 191 45.2 1.3e-06
P43214 Phl p 2 122 191 45.2 1.3e-06
P93124 Dac g 3 96 185 44.1 2.2e-06
2JNZ_A Phl p 3.0101 108 178 42.8 6.1e-06
CAA51775 Lol p 2 88 171 41.6 1.2e-05
P14948 Lol p 3 97 151 37.9 0.00017
CAA90746 Tri a 3 118 140 35.9 0.00083
AAP80171 Cyn d 15 112 129 33.9 0.0032
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 356.7 bits 1896,  Expect = 5e-100
 Identities = 275/275 100%, Positives = 275/275 100%, Gaps = 0/275 0%
Query  1    MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDG 60
            MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDG
Sbjct  1    MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDG 60
Query  61   SEGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITD 120
            SEGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITD
Sbjct  61   SEGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITD 120
Query  121  SCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMNVAFKVDA 180
            SCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMNVAFKVDA
Sbjct  121  SCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMNVAFKVDA 180
Query  181  GSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFS 240
            GSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFS
Sbjct  181  GSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFS 240
Query  241  IRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275
            IRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA
Sbjct  241  IRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275

Sequence Alignment: 2. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 184.5 bits 954,  Expect = 3e-48
 Identities = 141/255 55%, Positives = 188/255 73%, Gaps = 16/255 6%
Query  8    VFAVLVALPILSL-PVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDGSEGGAC 66
            ++++++ +P + + P   Y  +Y +   S         WS   ATWYG   GDGSEGGAC
Sbjct  18   ILSIFLVIPSFCFNPKKLYNASYYSPSSSD--------WSPAVATWYGPANGDGSEGGAC 69
Query  67   GYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCPGGV 126
            GY +AVGQ PFSS+I+AG P ++ +GKGCGSCY++KCTGN ACSG PV VVITD C G  
Sbjct  70   GYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAG-- 127
Query  127  CLNEAA-HFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNVAFKVDAGSNP 184
            C ++A  HFD+SG AFGAMA  G  + LR+AG + IQ++R+ C +   ++AF VD+GSN 
Sbjct  128  CGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQ 187
Query  185  YYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFSIRLT 244
             Y+A LV+Y +GDGDLA V + +A   G W +MQQSWGA W+++   G PL  PFSI+LT
Sbjct  188  EYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDK--GSPLRAPFSIKLT 245
Query  245  S-GSGKVLVANNVIPSGWQAGLTYRSTVNYA 274
            +  SG+ +VANNVIP+GW  G TYRS VN+A
Sbjct  246  TLESGQTIVANNVIPAGWTPGQTYRSIVNFA 276

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 165.2 bits 848,  Expect = 3e-42
 Identities = 131/252 51%, Positives = 173/252 68%, Gaps = 20/252 7%
Query  16   PILSLPVSGYEQNYTAGRRSTM--SLGRGYGWSSGGATWYGGPQGDGSE--GGACGYQSA 71
            P+   P +      + G  S+   S G G GW +  ATWYG P G G +  GGACG+++ 
Sbjct  61   PVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKN- 119
Query  72   VGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCPGGVCLNEA 131
            V   PFS+M + G   LFK+GKGCGSCYQI+C G+ ACSG P TV+ITD     V L   
Sbjct  120  VNLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSL--- 176
Query  132  AHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNVAFKVDAGSNPYYLAIL 190
             HFD+SGTAFGAMA     D LR AG++ IQ++RVPC++  + V F V+ GSNP Y+AIL
Sbjct  177  YHFDLSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAIL 236
Query  191  VQYANGDGDLAAVHIMKAR---GG------GGWKAMQQSWGATWRLNSNTGKPLSPPFSI 241
            V+Y NGDGD+  V +M++R   GG      G W  M++SWG+ WRL++N   PL  PFS+
Sbjct  237  VEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTN--HPLQGPFSL 294
Query  242  RLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            R+T+ SGK L+A+ VIP+ WQ    Y S V +
Sbjct  295  RITNESGKTLIADQVIPADWQPNTVYSSIVQF 326

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 163.2 bits 837,  Expect = 9e-42
 Identities = 133/264 50%, Positives = 180/264 68%, Gaps = 21/264 7%
Query  1    MVSR-GTFVFAVLVALPILSLPVS--GYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQ 57
            M +R G+ V A+L  L +L +  S  G+  NY     S      G GW    ATWYG P 
Sbjct  1    MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAY----GSGWLPARATWYGAPT 56
Query  58   GDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVT 115
            G G +  GGACG+++ V Q PFSSM + G   +FK+GKGCGSCYQI+C  + +CSG   T
Sbjct  57   GAGPDDNGGACGFKN-VNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIET 115
Query  116  VVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNV 174
            V+ITD     V      HFD+SGTAFGAMA  G+ D+LR +G++ IQ++RVPC +  + +
Sbjct  116  VIITDMNYYPVA---RYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKI 172
Query  175  AFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKAR---GG--GGWKAMQQSWGATWRLNS 229
             F V+ GSNP Y+A+LV+Y + DGD+  V +M+++   GG  G W  M++SWG+ WRL+S
Sbjct  173  NFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDS 232
Query  230  NTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYA 274
            N    L  PFS+R+ S SGK LVANNVIP+ W     YRS V ++
Sbjct  233  N--HRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS 275

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 159.7 bits 818,  Expect = 1e-40
 Identities = 121/224 54%, Positives = 157/224 70%, Gaps = 10/224 4%
Query  45   WSSGGATWYGGPQGDG--SEGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
            W    ATWYG P G G   +GGACG+++   Q PFSSM + G   +FK+GKGCGSCYQI+
Sbjct  42   WEVARATWYGAPTGAGPDDDGGACGFKNT-NQYPFSSMTSCGNEPIFKDGKGCGSCYQIR 100
Query  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
            C  + ACSG P TV+ITD     V      HFD+SGTAFGAMA  G  D+LR AG++ IQ
Sbjct  101  CVNHPACSGNPETVIITDMNYYPVS---KYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQ 157
Query  163  YKRVPCRF-AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSW 221
            +KRVPC F  + V F V+ GSNP Y+A+LV+Y +GDGD+  V +M+A     W  M++SW
Sbjct  158  FKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEA-NSQSWTPMRESW 216
Query  222  GATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275
            G+ WRL+SN    L+ PFS+R+T+ SGK LVA+ VIP+ W     YRS V Y++
Sbjct  217  GSIWRLDSN--HRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQYSS 268

Sequence Alignment: 6. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 155.9 bits 797,  Expect = 1e-39
 Identities = 126/264 47%, Positives = 167/264 63%, Gaps = 13/264 4%
Query  5    GTFVFAVLVALPILSLPVSGYEQNYTAGR--RSTMSLGRGYGWSSGGATWYGGPQGDGS- 61
            G  V+ +L+ L ++     G       GR    + ++G    W +  ATWYG P G G+ 
Sbjct  2    GVVVYYLLLVLVVVQ-GCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAA 60
Query  62   -EGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITD 120
              GGACG++  V Q PF  M + G   L+K GKGCGSCY+++C  N ACSG   TV ITD
Sbjct  61   DNGGACGFKK-VNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITD 119
Query  121  SCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNVAFKVD 179
                   L++  HFD+SG AFG +A  G  D LR AG++ +Q+ RVPC F  + V F V+
Sbjct  120  M--NYFPLSQY-HFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVE 176
Query  180  AGSNPYYLAILVQYANGDGDLAAVHIMKARGGGG-WKAMQQSWGATWRLNSNTGKPLSPP 238
             GS+P YLA+LV+Y NGDGD+A V + +A  GGG W  M++SWG+ WRL+SN    L  P
Sbjct  177  EGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN--HRLRAP 234
Query  239  FSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275
            FSIR+ S SGK LVA +VIP  W     YRS V Y++
Sbjct  235  FSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS 271

Sequence Alignment: 7. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 153.8 bits 786,  Expect = 6e-39
 Identities = 125/262 47%, Positives = 169/262 64%, Gaps = 19/262 7%
Query  1    MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDG 60
            M    +   A++  L +L   V       TA  RS  S     GW    ATWYG P G G
Sbjct  1    MAGVSSNAIALVALLSMLFTSVRSAVNYDTAVARSYTS-----GWLPAKATWYGAPNGAG 55
Query  61   SE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKC--TGNRACSGRPVTV 116
             +  GGACG+++ V Q P SSM A G   +F  G+GCG CY+IKC  + N +CSG+P  +
Sbjct  56   PDDNGGACGFKN-VNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRI 114
Query  117  VITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNVA 175
            VITD     V      H+D+SGTAFG+MA  G+ DRLR AG++ +Q++RVPC F  M V 
Sbjct  115  VITDMNYYPVA---RYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPGMKVT 171
Query  176  FKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGG---GGWKAMQQSWGATWRLNSNTG 232
            F V  GSNP YLA+LV+Y N DG +  + +M+   G   G W+ M++SWG+ WR+++N  
Sbjct  172  FHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTN-- 229
Query  233  KPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            +P+  PFSIR+TS +GK LVANN IP+ WQ    Y S + +
Sbjct  230  RPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAYWSNLQF 270

Sequence Alignment: 8. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 153.7 bits 785,  Expect = 7e-39
 Identities = 114/224 50%, Positives = 157/224 70%, Gaps = 14/224 6%
Query  45   WSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
            W+   ATWYG P G G +  GGACG++    Q PF SM + G   LFK+GKGCGSCY+I+
Sbjct  55   WTKARATWYGQPNGAGPDDNGGACGFKHT-NQYPFMSMTSCGNQPLFKDGKGCGSCYKIR 113
Query  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
            CT +++CSGR  TV+ITD     V      HFD+SGTAFG +A  G+ D+LR +G++ I+
Sbjct  114  CTKDQSCSGRSETVIITDMNYYPVA---PFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIE 170
Query  163  YKRVPCRF-AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGG-----WKA 216
            + RVPC F  + + F V+  SNP Y+A+LV+Y +GDGD+  V +M+++   G     W  
Sbjct  171  FTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTP 230
Query  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYA 274
            M++SWG+ WRL++N    L  PFSIR+ + SGK LVANNVIP+ W+    YRS V Y+
Sbjct  231  MRESWGSIWRLDTN--HRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286

Sequence Alignment: 9. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 149.3 bits 761,  Expect = 1e-37
 Identities = 112/223 50%, Positives = 155/223 69%, Gaps = 13/223 5%
Query  45   WSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
            W    ATWYG P G G +  GGACG+++   Q PF SM + G   LF++GKGCG+CYQI+
Sbjct  31   WLPAKATWYGQPNGAGPDDNGGACGFKNT-NQYPFMSMTSCGNEPLFQDGKGCGACYQIR 89
Query  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
            CT N +CSG+P TV+ITD     V      HFD+SGTAFGAMA  G+ D+LR AG++ IQ
Sbjct  90   CTNNPSCSGQPRTVIITDMNYYPV---ARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
Query  163  YKRVPCRF-AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGG----WKAM 217
            ++RVPC    + V F V+AGSNP YLA+LV++AN DG +  + +M++   G     W  M
Sbjct  147  FRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPM 206
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            ++SWG+ WRL++N    L  P S+R+ S SG+ ++A+ VIP+ W+A   Y S V +
Sbjct  207  RRSWGSIWRLDAN--HRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 10. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 148.2 bits 755,  Expect = 2e-37
 Identities = 110/222 49%, Positives = 152/222 68%, Gaps = 11/222 4%
Query  45   WSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
            W    ATWYG P G G +  GGACGY+  V + PF+SM A G P +FK+G GCGSCY+IK
Sbjct  4    WLDAKATWYGKPTGAGPDDNGGACGYKD-VNKAPFNSMGACGNPPIFKDGLGCGSCYEIK 62
Query  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
            C     CSG PV V ITD     +    A HFD++GTAFGAMA +G  ++LR AG++ +Q
Sbjct  63   CDKPAECSGEPVIVHITDQNYEPI---AAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQ 119
Query  163  YKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQS 220
            ++RV C++  N  +AF V+ G NP Y+A+L++YA GDGD+ AV I K +G   +  +++S
Sbjct  120  FRRVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDI-KEKGSEEFIPLKHS 178
Query  221  WGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            WGA WR++S   KP+  P ++RLTS  G  LV ++ IP GW+A   Y S + +
Sbjct  179  WGAIWRIDSP--KPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 148.2 bits 755,  Expect = 3e-37
 Identities = 115/255 45%, Positives = 166/255 65%, Gaps = 14/255 5%
Query  7    FVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDGSE--GG 64
            +++A +VA  ++S  VS        G   T + G+   W     TWYG P+G G +  GG
Sbjct  6    LLLACVVAAAMVS-AVSCGPPKVPPGPNITAAYGK--QWLEARGTWYGKPKGAGPDDNGG 62
Query  65   ACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCPG 124
            ACGY+  + + PF  M + G   +FK+GKGCGSC+++KC+   ACS +PV + ITD    
Sbjct  63   ACGYKD-IDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTE 121
Query  125  GVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFA--MNVAFKVDAGS 182
             +    A HFD+SG AFGAMA  G  + LR AG++ +Q++RV C++     V F V+ GS
Sbjct  122  PI---AAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGS 178
Query  183  NPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFSIR 242
            NP Y+A+LV+Y  GDGD+  V  +K +G   WK + +SWGA WR++  T KPL  PFS+R
Sbjct  179  NPNYFAVLVKYVGGDGDVVKVE-LKEKGSEEWKPLNESWGAIWRID--TPKPLKGPFSLR 235
Query  243  LTSGSGKVLVANNVIPSGWQAGLTYRSTV 271
            +T+ S + LVAN+VIP  W+A   Y+S +
Sbjct  236  VTTESDQKLVANDVIPDNWKANALYKSEI 264

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 148.0 bits 754,  Expect = 3e-37
 Identities = 114/260 43%, Positives = 167/260 64%, Gaps = 14/260 5%
Query  2    VSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDGS 61
            ++  ++++A +V   ++S  VS        G   T S G    W    ATWYG P+G G 
Sbjct  1    MASSSLLLACVVVAAMVS-AVSCGPPKVPPGPNITTSYGDK--WLEAKATWYGAPKGAGP 57
Query  62   E--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVIT 119
            +  GGACGY+  V + PF  M + G   +FK+GKGCGSC++IKC+   ACS +P  + +T
Sbjct  58   KDNGGACGYKD-VDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVT 116
Query  120  DSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMN--VAFK 177
            D     +    A HFD+SG AFGAMA  G  + LR AG++  Q++RV C++  +  + F 
Sbjct  117  DMNDEPIA---AYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFH 173
Query  178  VDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSP 237
            ++  SNP YLA+LV+Y  GDGD+  V I K +G   WKA+++SWGA WR++  T KPL  
Sbjct  174  IEKASNPNYLALLVKYVAGDGDVVEVEI-KEKGSEEWKALKESWGAIWRID--TPKPLKG 230
Query  238  PFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTV 271
            PFS+R+T+  G+ ++A + IP GW+A   Y+S V
Sbjct  231  PFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNV 264

Sequence Alignment: 13. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 145.8 bits 742,  Expect = 2e-36
 Identities = 111/221 50%, Positives = 147/221 66%, Gaps = 11/221 4%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY+  V + PFS M   G   +FK+G+GCGSC+
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKSGRGCGSCF 96
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   ACSG PV V ITD     +      HFD+SG AFGAMA +G   +LRSAG L
Sbjct  97   EIKCTKPEACSGEPVVVHITDDNEEPI---APYHFDLSGHAFGAMAKKGDEQKLRSAGEL 153
Query  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            ++Q++RV C++     V F V+ GSNP YLA+LV+Y NGDGD+ AV I K +G   W  +
Sbjct  154  ELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDI-KEKGKDKWIEL 212
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRS 269
            ++SWGA WR+  +T   L+ PF++R T+  G    A +VIP GW+A  +Y S
Sbjct  213  KESWGAIWRI--DTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYES 262

Sequence Alignment: 14. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 142.9 bits 726,  Expect = 1e-35
 Identities = 107/221 48%, Positives = 147/221 66%, Gaps = 11/221 4%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY+  V + PFS M   G   +FK+G+GCGSC+
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKSGRGCGSCF 96
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   +CSG P+ V ITD     +    A H+D+SG AFGAMA +G   +LRSAG L
Sbjct  97   EIKCTKPESCSGEPIVVHITDDNEEPI---AAYHLDLSGKAFGAMAKKGEEQKLRSAGEL 153
Query  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            +++++RV C +     V F V+ GSNP YLA+LV+Y +GDGD+ AV I K +G   W  +
Sbjct  154  ELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVDI-KEKGKDKWIEL 212
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRS 269
            ++SWGA WR+  +T   L+ PF++R T+  G  + A +VIP GW+A   Y S
Sbjct  213  KESWGAVWRV--DTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAYES 262

Sequence Alignment: 15. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 142.3 bits 723,  Expect = 2e-35
 Identities = 109/221 49%, Positives = 146/221 66%, Gaps = 11/221 4%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P   G +  GGACGY+  V + PFS M   G   +FK+G+GCGSC+
Sbjct  38   GDKWLDAKSTWYGKPTAAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKSGRGCGSCF 96
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   ACSG PV V ITD     +    A HFD+SG AFG+MA +G   +LRSAG +
Sbjct  97   EIKCTKPEACSGEPVVVHITDDNEEPI---AAYHFDLSGIAFGSMAKKGDEQKLRSAGEV 153
Query  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            +IQ++RV C++     V F V+ GSNP YLA+LV++  GDGD+ AV I K +G   W A+
Sbjct  154  EIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVDI-KEKGKDKWIAL 212
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRS 269
            ++SWGA WR+  +T + L  PF++R T+  G    A +VIP GW+A   Y S
Sbjct  213  KESWGAIWRI--DTPEVLKGPFTVRYTTEGGTKGEAKDVIPEGWKADTAYES 262

Sequence Alignment: 16. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 141.8 bits 720,  Expect = 2e-35
 Identities = 108/221 48%, Positives = 145/221 65%, Gaps = 11/221 4%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY+  V + PFS M   G   +FK+G+GCGSC+
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKAPFSGMTGCGNTPIFKSGRGCGSCF 96
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   +CSG PV V ITD     +    A HFD+SG AFGAMA +G   +LRSAG L
Sbjct  97   EIKCTKPESCSGEPVLVHITDDNEEPI---AAYHFDLSGKAFGAMAKKGEEQKLRSAGEL 153
Query  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            +++++RV C +     V F V+ GSNP YLA+LV+Y  GDGD+ AV I K +G   W  +
Sbjct  154  ELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVDI-KEKGKDKWIEL 212
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRS 269
            ++SWG+ WR+  +T   L+ PF++R T+  G    A +VIP GW+A   Y S
Sbjct  213  KESWGSIWRV--DTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 17. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 141.4 bits 718,  Expect = 3e-35
 Identities = 107/220 48%, Positives = 146/220 66%, Gaps = 13/220 5%
Query  45   WSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
            W    ATWYG P G G +  GGACG ++ V   P++   A G P +FK+GKGCGSCY+I+
Sbjct  42   WLPAKATWYGQPNGAGPDDNGGACGIKN-VNLPPYNGFTACGNPPIFKDGKGCGSCYEIR 100
Query  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
            C     CSG+PVTV ITD     +      HFD+SG AFGAMA  G+ D+LR  G++ ++
Sbjct  101  CN-KPECSGQPVTVFITDMNYEPI---APYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLE 156
Query  163  YKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQS 220
            ++RV C++     + F V+ GSNP YLA+LV++   DGD+  +  +K +    WK M+ S
Sbjct  157  FRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLME-LKEKSSD-WKPMKLS 214
Query  221  WGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            WGA WR+  +T K L PPFSIRLTS SGK ++A +VIP  W+    Y S V +
Sbjct  215  WGAIWRM--DTPKALVPPFSIRLTSESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 18. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 141.2 bits 717,  Expect = 4e-35
 Identities = 108/222 48%, Positives = 145/222 65%, Gaps = 11/222 4%
Query  45   WSSGGATWYGGPQGDGS--EGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
            W    ATWYG P G GS   GGACG ++ V   P++ MI+ G   +FK+G+GCGSCY++K
Sbjct  43   WLPARATWYGQPYGSGSTDNGGACGIKN-VNLPPYNGMISCGNVPIFKDGRGCGSCYEVK 101
Query  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
            C    ACS +PVTV ITD     +    A HFD SG AFGAMA  G    LR AG++ +Q
Sbjct  102  CEQPAACSKQPVTVFITDMNYEPI---SAYHFDFSGKAFGAMACPGKETELRKAGIIDMQ 158
Query  163  YKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQS 220
            ++RV C++     V F V+ GSNP YLA+LV++   DGD+  + + +A G   W+ M+ S
Sbjct  159  FRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEA-GLPAWRPMKLS 217
Query  221  WGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            WGA WR+++ T  PL  PFSIR+T+ SGK L+A +VIP  W     Y S V +
Sbjct  218  WGAIWRMDTAT--PLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 19. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 140.7 bits 714,  Expect = 5e-35
 Identities = 109/260 41%, Positives = 161/260 61%, Gaps = 16/260 6%
Query  5    GTFVFAVLVALPILSLPVSGYE---QNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDGS 61
            G++V  ++V   +L+  V+G          G    ++      W +  ATWYG P G G+
Sbjct  2    GSLVNNIMVVGAVLAALVAGGSCGPPKVPPG--PNITTNYNGKWLTARATWYGQPNGAGA 59
Query  62   --EGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVIT 119
               GGACG ++ V   P+S M A G   +FK+GKGCGSCY+++C     CSG PVTV IT
Sbjct  60   PDNGGACGIKN-VNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYIT 118
Query  120  DSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF--AMNVAFK 177
            D     +      HFD+SG AFG++A  G+ D++R  G++ ++++RV C++     + F 
Sbjct  119  DMNYEPI---APYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFH 175
Query  178  VDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSP 237
            ++ G NP YLA+LV+Y   DGD+  + I + +    WK M+ SWGA WR++  T K L  
Sbjct  176  IEKGCNPNYLAVLVKYVADDGDIVLMEI-QDKLSAEWKPMKLSWGAIWRMD--TAKALKG 232
Query  238  PFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            PFSIRLTS SGK ++A +VIP+ W+    Y S V +
Sbjct  233  PFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 20. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 140.5 bits 713,  Expect = 6e-35
 Identities = 106/221 47%, Positives = 146/221 66%, Gaps = 11/221 4%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY+  V + PFS M   G   +FK+G+GCGSC+
Sbjct  40   GDEWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKDGRGCGSCF 98
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   +CSG PVTV ITD     +      HFD+SG AFG+MA +G   +LRSAG L
Sbjct  99   EIKCTKPESCSGEPVTVHITDDNEEPI---APYHFDLSGHAFGSMAKKGEEQKLRSAGEL 155
Query  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            +++++RV C++       F V+ GSNP YLA+LV+Y +GDGD+ AV I K +G   W  +
Sbjct  156  ELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDI-KEKGKDKWIEL 214
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRS 269
            ++SWGA WR+  +T   L+ PF++R T+  G    A +VIP GW+A   Y +
Sbjct  215  KESWGAVWRV--DTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 264

Sequence Alignment: 21. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 140.0 bits 710,  Expect = 8e-35
 Identities = 105/221 47%, Positives = 146/221 66%, Gaps = 11/221 4%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY+  V + PFS M   G   +FK+G+GCGSC+
Sbjct  23   GDEWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKDGRGCGSCF 81
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKC+   +CSG PVTV ITD     +      HFD+SG AFG+MA +G   +LRSAG L
Sbjct  82   EIKCSKPESCSGEPVTVHITDDNEEPI---APYHFDLSGHAFGSMAKKGEEQKLRSAGEL 138
Query  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            +++++RV C++       F V+ GSNP YLA+LV+Y +GDGD+ AV I K +G   W  +
Sbjct  139  ELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDI-KEKGKDKWIEL 197
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRS 269
            ++SWGA WR+  +T   L+ PF++R T+  G    A +VIP GW+A   Y +
Sbjct  198  KESWGAVWRV--DTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247

Sequence Alignment: 22. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 139.4 bits 707,  Expect = 1e-34
 Identities = 110/225 48%, Positives = 148/225 65%, Gaps = 12/225 5%
Query  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
            G  W    AT+YG  P+G   +  GGACGY+  V + PF SM   G   +FK+G GCGSC
Sbjct  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDSMTGCGNEPIFKDGLGCGSC 91
Query  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  92   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 148
Query  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
            L +Q++RV C +  +  +AF V+ GSNP YLA+LV+YA GDG++ +V I K++G   +  
Sbjct  149  LMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-KSKGSDEFLP 207
Query  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            M+QSWGA WR++    KPL  PF+IRLTS SG  +   +VIP  W+    Y+S + +
Sbjct  208  MKQSWGAIWRIDPP--KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 23. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 139.4 bits 707,  Expect = 1e-34
 Identities = 110/225 48%, Positives = 148/225 65%, Gaps = 12/225 5%
Query  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
            G  W    AT+YG  P+G   +  GGACGY+  V + PF SM   G   +FK+G GCGSC
Sbjct  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDSMTGCGNEPIFKDGLGCGSC 91
Query  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  92   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 148
Query  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
            L +Q++RV C +  +  +AF V+ GSNP YLA+LV+YA GDG++ +V I K++G   +  
Sbjct  149  LMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-KSKGSDEFLP 207
Query  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            M+QSWGA WR++    KPL  PF+IRLTS SG  +   +VIP  W+    Y+S + +
Sbjct  208  MKQSWGAIWRIDPP--KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 24. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 138.9 bits 704,  Expect = 2e-34
 Identities = 104/219 47%, Positives = 144/219 65%, Gaps = 11/219 5%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY+  V + PF+ M   G   +FK+G+GCGSC+
Sbjct  27   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKAPFNGMTGCGNTPIFKDGRGCGSCF 85
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   +CSG  VTV ITD     +      HFD+SG AFG+MA +G    +RSAG L
Sbjct  86   EIKCTKPESCSGEAVTVTITDDNEEPIA---PYHFDLSGHAFGSMAKKGEEQNVRSAGEL 142
Query  160  KIQYKRVPCRFAMNV--AFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            ++Q++RV C++  +    F V+ GSNP YLAILV+Y +GDGD+ AV I K +G   W  +
Sbjct  143  ELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDI-KEKGKDKWIEL 201
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            ++SWGA WR+  +T   L+ PF++R T+  G      +VIP GW+A  +Y
Sbjct  202  KESWGAVWRI--DTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 249

Sequence Alignment: 25. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 138.7 bits 703,  Expect = 2e-34
 Identities = 104/219 47%, Positives = 143/219 65%, Gaps = 11/219 5%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY+  V + PF+ M   G   +FK+G+GCGSC+
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKAPFNGMTGCGNTPIFKDGRGCGSCF 96
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   +CSG  VTV ITD     +      HFD+SG AFG+MA +G   +LRSAG L
Sbjct  97   EIKCTKPESCSGEAVTVTITDDNEEPIA---PYHFDLSGHAFGSMAKKGEEQKLRSAGEL 153
Query  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            ++Q++RV C++       F V+  SNP YLAILV+Y +GDGD+ AV I K +G   W  +
Sbjct  154  ELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDI-KEKGKDKWIEL 212
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            ++SWGA WR+  +T   L+ PF++R T+  G      +VIP GW+A  +Y
Sbjct  213  KESWGAVWRI--DTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260

Sequence Alignment: 26. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 137.4 bits 696,  Expect = 5e-34
 Identities = 103/219 47%, Positives = 144/219 65%, Gaps = 11/219 5%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY++ V + PF+ M   G   +FK+G+GCGSC+
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKN-VDKAPFNGMTGCGNTPIFKDGRGCGSCF 96
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   +CSG  VTV ITD     +      HFD+SG AFG+MA +G    +RSAG L
Sbjct  97   EIKCTKPESCSGEAVTVTITDDNEEPIA---PYHFDLSGHAFGSMAKKGEEQNVRSAGEL 153
Query  160  KIQYKRVPCRFAMNV--AFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            ++Q++RV C++  +    F V+  SNP YLAILV+Y +GDGD+ AV I K +G   W  +
Sbjct  154  ELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDI-KEKGKDKWTEL 212
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            ++SWGA WR+  +T   L+ PF++R T+  G      +VIP GW+A  +Y
Sbjct  213  KESWGAVWRI--DTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 27. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 137.0 bits 694,  Expect = 7e-34
 Identities = 108/225 48%, Positives = 146/225 64%, Gaps = 12/225 5%
Query  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M   G   +FK+G  CGSC
Sbjct  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSC 91
Query  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  92   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 148
Query  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
            L +Q++RV C +  +  +AF V+ GSNP YLA+LV+YA GDG++ +V I K++G   +  
Sbjct  149  LMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-KSKGSDEFLP 207
Query  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            M+QSWGA WR++    KPL  PF+IRLTS SG  +   +VIP  W+    Y+S + +
Sbjct  208  MKQSWGAIWRIDPP--KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 28. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 137.0 bits 694,  Expect = 7e-34
 Identities = 103/219 47%, Positives = 144/219 65%, Gaps = 11/219 5%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY++ V + PF+ M   G   +FK+G+GCGSC+
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKN-VDKAPFNGMTGCGNTPIFKDGRGCGSCF 96
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            +IKCT   +CSG  VTV ITD     +      HFD+SG AFG+MA +G    +RSAG L
Sbjct  97   EIKCTKPESCSGEAVTVTITDDNEEPIA---PYHFDLSGHAFGSMAKKGEEQNVRSAGEL 153
Query  160  KIQYKRVPCRFAMNV--AFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            ++Q++RV C++  +    F V+  SNP YLAILV+Y +GDGD+ AV I K +G   W  +
Sbjct  154  ELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDI-KEKGKDKWIEL 212
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            ++SWGA WR+  +T   L+ PF++R T+  G      +VIP GW+A  +Y
Sbjct  213  KESWGAVWRI--DTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 29. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 136.1 bits 689,  Expect = 1e-33
 Identities = 109/227 48%, Positives = 145/227 63%, Gaps = 12/227 5%
Query  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M A G   +FK+G GC +C
Sbjct  15   GSKWLEARATFYGSNPRGAAPDDHGGACGYKD-VDKPPFDGMTACGNEPIFKDGLGCRAC 73
Query  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
            Y+IKC     CSG PV V ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  74   YEIKCKEPVECSGEPVLVKITDKNYEHIA---AYHFDLSGKAFGAMAKKGQEDKLRKAGE 130
Query  159  LKIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
            L +Q++RV C++     + F ++ GSN +YLA+LV+YA GDG++ AV I K R    +  
Sbjct  131  LTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDI-KPRDSDEFIP 189
Query  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275
            M+ SWGA WR++    KPL  PFSIRLTS  G  LV ++VIP+ W+    Y S + + A
Sbjct  190  MKSSWGAIWRIDPK--KPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA 246

Sequence Alignment: 30. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 136.0 bits 688,  Expect = 1e-33
 Identities = 107/225 47%, Positives = 145/225 64%, Gaps = 12/225 5%
Query  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M   G   +FK+G  CGSC
Sbjct  15   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSC 73
Query  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  74   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 130
Query  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
            L +Q++RV C +  +  +AF V+ GS+P YLA+LV+YA GDG++  V I K +G   +  
Sbjct  131  LMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI-KPKGSDEFLP 189
Query  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            M+QSWGA WR++    KPL  PF+IRLTS SG  +  ++VIP  W+    Y+S + +
Sbjct  190  MKQSWGAIWRMDPP--KPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 31. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 135.8 bits 687,  Expect = 1e-33
 Identities = 107/225 47%, Positives = 145/225 64%, Gaps = 12/225 5%
Query  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M   G   +FK+G  CGSC
Sbjct  15   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSC 73
Query  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  74   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 130
Query  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
            L +Q++RV C +  +  +AF V+ GS+P YLA+LV+YA GDG++  V I K +G   +  
Sbjct  131  LMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI-KPKGSDEFLP 189
Query  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            M+QSWGA WR++    KPL  PF+IRLTS SG  +  ++VIP  W+    Y+S + +
Sbjct  190  MKQSWGAIWRIDPP--KPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 32. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 135.6 bits 686,  Expect = 2e-33
 Identities = 99/215 46%, Positives = 142/215 66%, Gaps = 11/215 5%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    +TWYG P G G +  GGACGY+  V + PF+ M   G   +FK+G+GCGSC+
Sbjct  44   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKAPFNGMTGCGNTPIFKDGRGCGSCF 102
Query  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
            ++KC+   +CSG P+TV ITD     +      HFD+SG AFG+MA +G  + +R AG L
Sbjct  103  ELKCSKPESCSGEPITVHITDDNEEPIA---PYHFDLSGHAFGSMAKKGEEENVRGAGEL 159
Query  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            ++Q++RV C++       F V+ GSNP YLA+LV+Y +GDGD+ AV I K +G   W  +
Sbjct  160  ELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDGDVVAVDI-KEKGKDKWIEL 218
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQA 263
            ++SWGA WR++  T   L+ PF++R T+  G      +VIP GW+A
Sbjct  219  KESWGAIWRID--TPDKLTGPFTVRYTTEGGTKAEFEDVIPEGWKA 262

Sequence Alignment: 33. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 134.3 bits 679,  Expect = 4e-33
 Identities = 106/225 47%, Positives = 143/225 63%, Gaps = 12/225 5%
Query  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M   G   +FK+G GCGSC
Sbjct  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLGCGSC 91
Query  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  92   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 148
Query  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
            L +Q++RV C +  +  + F V+ GS+P YLA+LV+YA GDG++  V I K +G   +  
Sbjct  149  LMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDI-KPKGSDVFLP 207
Query  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            M+ SWGA WR++    KPL  PF+IRLTS SG  +   +VIP  W+    Y+S + +
Sbjct  208  MKLSWGAIWRMDPP--KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 34. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 133.9 bits 677,  Expect = 6e-33
 Identities = 105/222 47%, Positives = 141/222 63%, Gaps = 12/222 5%
Query  45   WSSGGATWYGG-PQGDG--SEGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQI 101
            W    AT+YG  P+G     +GGACGY++ V + PF  M   G   +FK+G GCGSC++I
Sbjct  46   WQDAKATFYGSNPRGAAPDDDGGACGYKN-VDKAPFFGMTGCGNEPIFKDGLGCGSCFEI 104
Query  102  KCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKI 161
            KC     CS +PV + ITD     +    A HFD+SG AFG+MA +G  D LR AG L +
Sbjct  105  KCKEPAECSDKPVLIRITDKNYEHI---AAYHFDLSGKAFGSMAKQGQEDNLRKAGELTL 161
Query  162  QYKRVPCRFA--MNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQ 219
            Q++RV C +     + F V+ G N  YLA+LV+YA GDGD+ AV I K +G   +  M+ 
Sbjct  162  QFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDI-KPKGSDEFLPMKP 220
Query  220  SWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
            SWGA WR++    KPL  PF++RLTS SG  LV  +VIP+ W+    Y S + Y
Sbjct  221  SWGAIWRIDPK--KPLKGPFTVRLTSESGAKLVQEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 35. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 131.8 bits 665,  Expect = 2e-32
 Identities = 100/218 45%, Positives = 144/218 66%, Gaps = 12/218 5%
Query  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
            G  W    ATWYG P G G +  GGACGY+  V + PF+SM A G   +FK+G  CGSC+
Sbjct  15   GSDWLERKATWYGKPTGAGPDDNGGACGYKD-VNKAPFNSMGACGNLPIFKDGL-CGSCF 72
Query  100  QIKCTGNRA--CSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAG 157
            +IKC   +   CSG  V V ITD     +    A HFD++G AFGAMA +G  ++L  AG
Sbjct  73   EIKCDKPKPAECSGEAVVVHITDMNYEQIA---AYHFDLAGHAFGAMAKKGQEEKLAKAG 129
Query  158  VLKIQYKRVPCRFAMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
            ++ ++++RV C++   V F V+ GSNP YLA+LV+Y +GDGD+  V I K +GG  ++ +
Sbjct  130  IIDMKFRRVKCKYGEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDI-KEKGGDAYQPL 188
Query  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            ++SWGA WR +S    P+  P ++++T+  G     ++VIP GW+A  TY
Sbjct  189  KHSWGAIWRKDSPD--PIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTY 236

Sequence Alignment: 36. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 118.8 bits 594,  Expect = 1e-28
 Identities = 83/188 44%, Positives = 123/188 65%, Gaps = 8/188 4%
Query  80   MIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGT 139
            M A G   +FK+GKGCGSCY+++C     CSG PVTV ITD     +      HFD+SG 
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIA---PYHFDLSGK 57
Query  140  AFGAMANRGMGDRLRSAGVLKIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGD 197
            AFG++A  G+ D+LR  G++ ++++RV C++     + F ++ G NP Y+A+LV++   D
Sbjct  58   AFGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADD 117
Query  198  GDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVI 257
            GD+  + I + +    WK M+ SWGA WR++  T K L  PFSIRLTS SGK ++A ++I
Sbjct  118  GDIVLMEI-QDKLSAEWKPMKLSWGAIWRMD--TAKALKGPFSIRLTSESGKKVIAKDII 174
Query  258  PSGWQAGLTYRSTVNY 273
            P+ W+    Y S V +
Sbjct  175  PANWRPDAVYTSNVQF 190

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 117.1 bits 585,  Expect = 7e-28
 Identities = 91/200 45%, Positives = 129/200 64%, Gaps = 15/200 7%
Query  63   GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSC 122
            GGACGY+  V + PF  M + G   +FK+GKGCGSC++IKC+   ACS +P  + +TD  
Sbjct  61   GGACGYKD-VDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMN 119
Query  123  PGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMN--VAFKVDA 180
               +    A HFD+SG A   MA  G  + LR AG++  Q++RV C++  +  + F ++ 
Sbjct  120  DEPIA---AYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEK 173
Query  181  GSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFS 240
             SNP YLA+LV+Y  GDGD+  V I K +G   WKA+++SWGA WR++  T KPL  PFS
Sbjct  174  ASNPNYLALLVKYVAGDGDVVEVEI-KEKGSEEWKALKESWGAIWRID--TPKPLKGPFS 230
Query  241  IRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275
            +R+T+   +   A + IP     G   R  VN  A
Sbjct  231  VRVTTEGARRSSAEDAIP---DPGRRQRVQVNVQA 262

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 89.2 bits 432,  Expect = 2e-19
 Identities = 80/195 41%, Positives = 121/195 62%, Gaps = 22/195 11%
Query  64   GACGYQS-AVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSC 122
            GAC Y S A G   F+  IAA  PS++K+G GCG+C+Q++C     CS +  TV++TD  
Sbjct  43   GACAYGSMATGF--FAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTD-- 98
Query  123  PGGVCLNEAAHFDM--SGTAFGAMANRGMG-DR-LRSAGVLKIQYKRVPCRFA---MNVA 175
                 LN+  + D+  S  AF AMA   +G DR L   G++ I+Y+RVPC +    MNV 
Sbjct  99   -----LNKTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDYGNKKMNVR 153
Query  176  FKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPL 235
             + ++  NP YLAI + Y  G  ++ A++I +  G   W  M +S GA W  +      L
Sbjct  154  VE-ESSKNPNYLAIKLLYQGGQTEVVAIYIAQV-GSSHWSYMTRSHGAVWVTDKVPNGAL 211
Query  236  SPPFSIRLTSG-SGKVLVANNVIPSGWQAGLTYRSTV 271
               F   +T+G  GK++ +  V+P+ W+AG +Y + V
Sbjct  212  Q--FRFVVTAGYDGKMVWSQRVLPANWEAGKSYDAGV 246

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 87.0 bits 420,  Expect = 8e-19
 Identities = 79/218 36%, Positives = 127/218 58%, Gaps = 25/218 11%
Query  45   WSSGGATWYGGPQGDGSE-GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKC 103
            W  G AT+YG P G G + GGACGY S      +S+  AA    LF +G GCG CY+++C
Sbjct  52   WHDGSATFYGDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRC 111
Query  104  TGNRACS-GRPVTVVI-TDSCP---------GGVCLNEAAHFDMSGTAFGAMANRGMGDR 152
              +  C+ G P  V+  T+ CP         GG C     HFDM+  +F  +A R     
Sbjct  112  VKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQR----- 166
Query  153  LRSAGVLKIQYKRVPCRFAMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGG 212
               AG++ +QY+RVPC+    V F +    N Y+L + V    G GD++++ +  + GGG
Sbjct  167  --VAGIVPVQYRRVPCQRTGGVRFCLQG--NHYWLLLYVMNVGGAGDVSSLSVKTSGGGG 222
Query  213  GWKAMQQSWGATWRLNSNTGKPLSPPFSIRLTSGSG--KVLVANNVIPSGWQAGLTYRST 270
             W    ++WG T+++ +      S  ++++LT+ S   + ++ ++ I   W  GL Y+ +
Sbjct  223  AWIQAAHNWGITYQVFAALDN--SDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGS 280
Query  271  VNY 273
             N+
Sbjct  281  NNF 283

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 84.6 bits 407,  Expect = 4e-18
 Identities = 72/203 35%, Positives = 106/203 52%, Gaps = 13/203 6%
Query  64   GACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCP 123
            G+CGY S          +AA  P+LF+ G GCG+C+Q++C   + CS     VV+TD   
Sbjct  52   GSCGYGSLAASFN-GGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEAR 110
Query  124  GGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAM--NVAFKVDAG 181
                      + +S  A+ AMA  GM  +LR+   + ++YKRVPC +A   N++ +V+  
Sbjct  111  S----TNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
Query  182  SNP-YYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFS 240
            S P   L+I   Y  G  D+ AV +    G   WK M + +G  W        PL   F 
Sbjct  167  SRPPRELSIRFLYQGGQTDIVAVDVATV-GSSNWKFMTRDYGPAWSTAQAPAGPLQ--FR 223
Query  241  IRLTSG-SGKVLVANN-VIPSGWQAGLTYRSTVNYA 274
            + +T G  GK + A+  V+P  W AG  Y + V  A
Sbjct  224  VVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQIA 259

Sequence Alignment: 41. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 46.0 bits 195,  Expect = 6e-07
 Identities = 33/95 34%, Positives = 55/95 57%, Gaps = 3/95 3%
Query  171  AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSN 230
            A  V F V+ GS+   LA+ ++Y N +GD  A   +K  G   W A++++    W + S+
Sbjct  1    AAPVEFTVEKGSDEKNLALSIKY-NKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSD 59
Query  231  TGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYR 268
              KPL  PF+ R+ S  G   V ++V+P+ ++ G TY+
Sbjct  60   --KPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 45.2 bits 191,  Expect = 1e-06
 Identities = 33/89 37%, Positives = 51/89 57%, Gaps = 5/89 5%
Query  174  VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGK 233
            V F V+ GSN  +LA+LV+Y   +GD  A   ++  G   W AM +  G  W ++S   +
Sbjct  30   VTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSE--E 84
Query  234  PLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            PL  PF+ R+ +  G   V ++V+P  +  G TY
Sbjct  85   PLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 45.2 bits 191,  Expect = 1e-06
 Identities = 33/89 37%, Positives = 51/89 57%, Gaps = 5/89 5%
Query  174  VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGK 233
            V F V+ GSN  +LA+LV+Y   +GD  A   ++  G   W AM +  G  W ++S   +
Sbjct  30   VTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSE--E 84
Query  234  PLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            PL  PF+ R+ +  G   V ++V+P  +  G TY
Sbjct  85   PLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 45.2 bits 191,  Expect = 1e-06
 Identities = 33/89 37%, Positives = 51/89 57%, Gaps = 5/89 5%
Query  174  VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGK 233
            V F V+ GSN  +LA+LV+Y   +GD  A   ++  G   W AM +  G  W ++S   +
Sbjct  30   VTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSE--E 84
Query  234  PLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            PL  PF+ R+ +  G   V ++V+P  +  G TY
Sbjct  85   PLKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 45.2 bits 191,  Expect = 1e-06
 Identities = 33/89 37%, Positives = 51/89 57%, Gaps = 5/89 5%
Query  174  VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGK 233
            V F V+ GSN  +LA+LV+Y   +GD  A   ++  G   W AM +  G  W ++S   +
Sbjct  30   VTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSE--E 84
Query  234  PLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
            PL  PF+ R+ +  G   V ++V+P  +  G TY
Sbjct  85   PLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 44.1 bits 185,  Expect = 2e-06
 Identities = 32/92 34%, Positives = 52/92 56%, Gaps = 4/92 4%
Query  172  MNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNT 231
            + V FKV+ GS+P  L + ++Y      LA V  ++  G   W+ + +  G  W + S+ 
Sbjct  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVE-LRQHGSEEWEPLTKK-GNLWEVKSS- 57
Query  232  GKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
             KPL+ PF+ R+ S  G   V + VIP+ ++ G TY
Sbjct  58   -KPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 47. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 42.8 bits 178,  Expect = 6e-06
 Identities = 32/94 34%, Positives = 50/94 53%, Gaps = 4/94 4%
Query  171  AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSN 230
            A+ V F V  GS+P  L + ++Y      LA V  ++  G   W+ + +  G  W + S+
Sbjct  12   AVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVE-LRQHGSEEWEPLTKK-GNVWEVKSS 69
Query  231  TGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYR 268
              KPL  PF+ R+ S  G   V + VIP+ +  G TY+
Sbjct  70   --KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 48. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 41.6 bits 171,  Expect = 1e-05
 Identities = 28/86 32%, Positives = 50/86 58%, Gaps = 3/86 3%
Query  176  FKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPL 235
            F V+ GS+   LA+ ++Y+  +GD  A   +K  G   W A++++    W + S+  KPL
Sbjct  2    FTVEKGSDEKNLALSIKYSK-EGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSD--KPL 58
Query  236  SPPFSIRLTSGSGKVLVANNVIPSGWQAG 264
              PF+ R+ S  G   V ++V+P+ ++ G
Sbjct  59   KGPFNFRFVSEKGMWNVFDDVVPADFKVG 87

Sequence Alignment: 49. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 37.9 bits 151,  Expect = 0.0002
 Identities = 30/95 31%, Positives = 47/95 49%, Gaps = 4/95 4%
Query  174  VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGK 233
            V + V+ GS+   L + ++Y      LA V  ++  G   W+ M +  G  W + S   K
Sbjct  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVE-LRQHGSEEWEPMTKK-GNLWEVKS--AK 58
Query  234  PLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVN 272
            PL+ P + R+ S  G   V + VIP+ +  G TY    N
Sbjct  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEYN 97

Sequence Alignment: 50. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 35.9 bits 140,  Expect = 0.0008
 Identities = 27/93 29%, Positives = 49/93 52%, Gaps = 4/93 4%
Query  171  AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSN 230
            A+ V + V  GS+   LA+ + Y   +  L+ V  ++  G   W+ + +  G  W ++ +
Sbjct  22   AVKVKLTVQKGSDKKKLALKIDYTRPNDSLSEVE-LRQYGSEEWQPLTKK-GDVWEVSCS 79
Query  231  TGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267
              KPL  PF+ R+ S +G   V + V  + ++ G TY
Sbjct  80   --KPLVGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTY 114

Sequence Alignment: 51. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 33.9 bits 129,  Expect = 0.003
 Identities = 28/92 30%, Positives = 52/92 56%, Gaps = 10/92 10%
Query  172  MNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNT 231
            +N+ F V+  S  + L+I     +   ++  V + +  G      M +S G +W ++   
Sbjct  20   VNIIFHVEESSPKFALSI----KDSAKEITQVDV-REHGADNMDPMTKS-GDSWTID--- 70
Query  232  GKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273
             KPL  P++IRL +  G   V ++VIP  W+AG  Y + +++
Sbjct  71   -KPLKGPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.