The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MWCSILLAAVMVAVAGGQSRFSYDGTPLADDVVVGSGQRQQFFASRQPRPQQLFVQERPQ
QVFVQQQPQPPVFVQPEPQQVFVQPQPRPMFQMLPSFSQQAAVIQSVQPQVSSACPATYS
LVHTTYQGRVYHSSWCNLPGHRFSQSAARDYCRGLGEVTVMNRRGSFDLYSVDRTTDFDY
FFELLLQHQIPSVWTRDLASTAPYEIRGSITRSGDSTAGQDCLSLEASTDGLFLLQDSCS
DRKAAVCVAHWQ
Sequence Info Allergen Name Length Opt Bits Score E Value
Q5QKR2 Eri s 2.0101 252 1743 335.7 8.9e-94
BAA11251 Tri a gliadin 279 197 46.2 1.4e-06
AAA34274 Tri a gliadin 291 184 43.7 8.3e-06
AAA34289 Tri a gliadin 327 182 43.3 1.3e-05
AAA34288 Tri a gliadin 251 176 42.3 1.9e-05
BAN29066 Tri a 20.0101 279 176 42.2 2.2e-05
CAA59339 Tri a glutenin 261 171 41.4 3.8e-05
AAA34272 Tri a gliadin 302 168 40.7 7e-05
P80198 Hor v 21 289 159 39.0 0.00021
P80198 Hor v 20.0101 289 159 39.0 0.00021
CAA31685 Tri a glutenin 307 159 39.0 0.00023
CAY54134 Tri a 21.0101 281 156 38.5 0.0003
AAA34276 Tri a gliadin 291 154 38.1 0.00041
AEH31546 Tri a 36.0101 369 156 38.3 0.00045
CAA59340 Tri a glutenin 276 152 37.8 0.00049
AAA34283 Tri a gliadin 282 147 36.8 0.00096
AAA34282 Tri a gliadin 297 138 35.1 0.0034
AAA34285 Tri a gliadin 304 135 34.5 0.0051
CAA44473 Tri a glutenin 285 134 34.4 0.0053
AAA34281 Tri a gliadin 262 133 34.2 0.0053
AAA17741 Tri a gliadin 287 133 34.2 0.0061
CAA30570 Tri a glutenin 356 132 33.8 0.0096
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Eri s 2.0101 Sequence ID: Q5QKR2

 Score = 335.7 bits 1743,  Expect = 9e-94
 Identities = 252/252 100%, Positives = 252/252 100%, Gaps = 0/252 0%
Query  1    MWCSILLAAVMVAVAGGQSRFSYDGTPLADDVVVGSGQRQQFFASRQPRPQQLFVQERPQ 60
            MWCSILLAAVMVAVAGGQSRFSYDGTPLADDVVVGSGQRQQFFASRQPRPQQLFVQERPQ
Sbjct  1    MWCSILLAAVMVAVAGGQSRFSYDGTPLADDVVVGSGQRQQFFASRQPRPQQLFVQERPQ 60
Query  61   QVFVQQQPQPPVFVQPEPQQVFVQPQPRPMFQMLPSFSQQAAVIQSVQPQVSSACPATYS 120
            QVFVQQQPQPPVFVQPEPQQVFVQPQPRPMFQMLPSFSQQAAVIQSVQPQVSSACPATYS
Sbjct  61   QVFVQQQPQPPVFVQPEPQQVFVQPQPRPMFQMLPSFSQQAAVIQSVQPQVSSACPATYS 120
Query  121  LVHTTYQGRVYHSSWCNLPGHRFSQSAARDYCRGLGEVTVMNRRGSFDLYSVDRTTDFDY 180
            LVHTTYQGRVYHSSWCNLPGHRFSQSAARDYCRGLGEVTVMNRRGSFDLYSVDRTTDFDY
Sbjct  121  LVHTTYQGRVYHSSWCNLPGHRFSQSAARDYCRGLGEVTVMNRRGSFDLYSVDRTTDFDY 180
Query  181  FFELLLQHQIPSVWTRDLASTAPYEIRGSITRSGDSTAGQDCLSLEASTDGLFLLQDSCS 240
            FFELLLQHQIPSVWTRDLASTAPYEIRGSITRSGDSTAGQDCLSLEASTDGLFLLQDSCS
Sbjct  181  FFELLLQHQIPSVWTRDLASTAPYEIRGSITRSGDSTAGQDCLSLEASTDGLFLLQDSCS 240
Query  241  DRKAAVCVAHWQ 252
            DRKAAVCVAHWQ
Sbjct  241  DRKAAVCVAHWQ 252

Sequence Alignment: 2. Allergen Name: Tri a gliadin Sequence ID: BAA11251

 Score = 46.2 bits 197,  Expect = 1e-06
 Identities = 45/115 39%, Positives = 64/115 55%, Gaps = 14/115 12%
Query  39   RQQFFASRQP---RPQQLFVQERPQQVFVQ-QQPQPPVFVQPEPQQVFVQPQ---PRPMF 91
            +QQF   +QP   +PQQ + Q RPQQ F Q QQPQ P     +PQQ F QPQ   P+P  
Sbjct  55   QQQFIQPQQPFPQQPQQTYPQ-RPQQPFPQTQQPQQPFPQSQQPQQPFPQPQQQFPQPQ- 112
Query  92   QMLPSFSQQ--AAVIQSVQPQVSSACPATYSLVHTTYQGRVYHSSWCNLPGHRFSQSAAR 149
            Q   SF QQ  + + QS+Q Q++   P    L++      +  S W  +      Q   +
Sbjct  113  QPQQSFPQQQPSLIQQSLQQQLN---PCKNFLLQQCKPVSLVSSLWSMILPRSDCQVMRQ 169
Query  150  DYCRGLGEV 158
              C+ L ++
Sbjct  170  QCCQQLAQI 178

Sequence Alignment: 3. Allergen Name: Tri a gliadin Sequence ID: AAA34274

 Score = 43.7 bits 184,  Expect = 8e-06
 Identities = 44/112 39%, Positives = 65/112 58%, Gaps = 13/112 11%
Query  39   RQQFFASRQP---RPQQLFVQERPQQVFVQ-QQPQPPVFVQPEPQQVFVQPQPRPMFQML 94
            +QQF+  RQP   +PQQ + Q+ PQQ F Q QQPQ P     +PQQ F QPQ +P  Q +
Sbjct  74   QQQFLQPRQPFPQQPQQPYPQQ-PQQPFPQTQQPQQPFPQSKQPQQPFPQPQ-QPQ-QSF 130
Query  95   PSFSQQAAVIQ-SVQPQVSSACPATYSLVHTTYQGRVYHSSWCNLPGHRFSQSAARDYCR 153
            P   QQ ++IQ S+Q Q++   P    L++      +  S W  +      Q   +  C+
Sbjct  131  PQ--QQPSLIQQSLQQQLN---PCKNFLLQQCKPVSLVSSLWSIILPPSDCQVMRQQCCQ 185
Query  154  GLGEV 158
             L ++
Sbjct  186  QLAQI 190

Sequence Alignment: 4. Allergen Name: Tri a gliadin Sequence ID: AAA34289

 Score = 43.3 bits 182,  Expect = 1e-05
 Identities = 46/115 40%, Positives = 63/115 54%, Gaps = 12/115 10%
Query  38   QRQQFFASRQPRPQQLFVQERPQQVFVQ-QQPQPPVFVQPEPQQVFVQPQ---PRPMFQM 93
            Q QQ F   Q +PQQ F Q+ PQQ F Q QQPQ P     +PQQ F QPQ   P+P  Q 
Sbjct  105  QPQQPFPQTQ-QPQQPFPQQ-PQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQ-QP 161
Query  94   LPSFSQQA-AVIQ-SVQPQVSSACPATYSLVHTTYQGRVYHSSWCNLPGHRFSQSAARDY 151
              SF QQ    IQ S+Q Q++   P    L++ +    +  S W  +  +   Q   +  
Sbjct  162  QQSFPQQQRPFIQPSLQQQLN---PCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQC 218
Query  152  CRGLGEV 158
            C+ L ++
Sbjct  219  CQQLAQI 225

Sequence Alignment: 5. Allergen Name: Tri a gliadin Sequence ID: AAA34288

 Score = 42.3 bits 176,  Expect = 2e-05
 Identities = 47/114 41%, Positives = 67/114 58%, Gaps = 16/114 14%
Query  39   RQQFFASRQP---RPQQLFVQERPQQVFVQ-QQPQPPVFVQPE-PQQVFVQPQ---PRPM 90
            +QQF+  +QP   +PQQ + Q+ PQQ F Q QQPQ  +F Q + PQQ F QPQ   P+P 
Sbjct  74   QQQFLQPQQPFPQQPQQPYPQQ-PQQPFPQTQQPQQ-LFPQSQQPQQQFSQPQQQFPQPQ 131
Query  91   FQMLPSF-SQQAAVIQ-SVQPQVSSACPATYSLVHTTYQGRVYHSSWCNLPGHRFSQSAA 148
             Q   SF  QQ   IQ S+Q QV+   P    L++      +  S W  +  +   Q   
Sbjct  132  -QPQQSFPQQQPPFIQPSLQQQVN---PCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMR 187
Query  149  RDYCRGLGEV 158
            +  C+ L ++
Sbjct  188  QQCCQQLAQI 197

Sequence Alignment: 6. Allergen Name: Tri a 20.0101 Sequence ID: BAN29066

 Score = 42.2 bits 176,  Expect = 2e-05
 Identities = 47/114 41%, Positives = 67/114 58%, Gaps = 16/114 14%
Query  39   RQQFFASRQP---RPQQLFVQERPQQVFVQ-QQPQPPVFVQPE-PQQVFVQPQ---PRPM 90
            +QQF+  +QP   +PQQ + Q+ PQQ F Q QQPQ  +F Q + PQQ F QPQ   P+P 
Sbjct  55   QQQFLQPQQPFPQQPQQPYPQQ-PQQPFPQTQQPQQ-LFPQSQQPQQQFSQPQQQFPQPQ 112
Query  91   FQMLPSF-SQQAAVIQ-SVQPQVSSACPATYSLVHTTYQGRVYHSSWCNLPGHRFSQSAA 148
             Q   SF  QQ   IQ S+Q QV+   P    L++      +  S W  +  +   Q   
Sbjct  113  -QPQQSFPQQQPPFIQPSLQQQVN---PCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMR 168
Query  149  RDYCRGLGEV 158
            +  C+ L ++
Sbjct  169  QQCCQQLAQI 178

Sequence Alignment: 7. Allergen Name: Tri a glutenin Sequence ID: CAA59339

 Score = 41.4 bits 171,  Expect = 4e-05
 Identities = 53/154 34%, Positives = 77/154 50%, Gaps = 24/154 15%
Query  18   QSRFSYDGTPLADDVVVGSGQRQQFFASRQPR-PQQL-FVQERPQQVFVQQQPQPPVFVQ 75
            Q  FS    P+       S Q+QQF   +QP  PQQ  F Q++P   F QQQ QPP F Q
Sbjct  61   QPPFSQQQQPILPQQPPFSQQQQQFPQQQQPLLPQQPPFSQQQPP--FSQQQQQPP-FSQ 117
Query  76   PEPQQVFVQPQPRPMFQMLPSFSQQAAVIQSVQPQVSSACPATYSLVHTTYQGRVYHSSW 135
             + Q +++Q  P    Q  P + QQ   I SVQP          S+++     +V+    
Sbjct  118  QQQQPILLQQPPFSQHQQ-PVLPQQQ--IPSVQP----------SILQQLNPCKVFLQQQ 164
Query  136  CNLPGHRFSQSAARDYCRGLGEVTVMNRRGSFDLYSVDRTTDFD----YFFELLLQHQ 189
            C+ P     QS AR          VM ++    L  +   + +D      + ++LQ Q
Sbjct  165  CS-PVA-MPQSLARSQMLWQSSCHVMQQQCCRQLPQIPEQSRYDAIRAIIYSIVLQEQ 220

Sequence Alignment: 8. Allergen Name: Tri a gliadin Sequence ID: AAA34272

 Score = 40.7 bits 168,  Expect = 7e-05
 Identities = 39/76 51%, Positives = 48/76 63%, Gaps = 18/76 23%
Query  39   RQQFFASRQPR-----PQQLFVQE-------RPQQVFVQ-QQPQPPVFVQPEPQQVFVQP 85
            +QQF  ++QP+     PQQ F Q+       +PQQ F Q QQPQ P     +PQQ F QP
Sbjct  79   QQQFPQTQQPQQPFPQPQQTFPQQPQLPFPQQPQQPFPQPQQPQQPFPQSQQPQQPFPQP 138
Query  86   Q---PRPMFQMLPSF-SQQAAVIQSVQPQVSSAC 115
            Q   P+P  Q   SF  QQ   IQS   Q  + C
Sbjct  139  QQQFPQPQ-QPQQSFPQQQQPAIQSFLQQQMNPC 171

Sequence Alignment: 9. Allergen Name: Hor v 21 Sequence ID: P80198

 Score = 39.0 bits 159,  Expect = 0.0002
 Identities = 35/77 45%, Positives = 45/77 58%, Gaps = 12/77 15%
Query  40   QQFFASRQPRPQQL-FVQERPQQVFVQQQPQP---PVFVQPE-PQQ-VFVQPQPRPMF-Q 92
            QQ+F   QP PQQ  F+Q+ P+Q + QQQP P   P   QP+ P+Q  F Q  P+  F Q
Sbjct  19   QQLFPQWQPLPQQPPFLQQEPEQPYPQQQPLPQQQPFPQQPQLPHQHQFPQQLPQQQFPQ 78
Query  93   MLP-----SFSQQAAVIQSVQPQVSSACP 116
             +P      F QQ  +    QPQ     P
Sbjct  79   QMPLQPQQQFPQQMPLQPQQQPQFPQQKP 107

Sequence Alignment: 10. Allergen Name: Hor v 20.0101 Sequence ID: P80198

 Score = 39.0 bits 159,  Expect = 0.0002
 Identities = 35/77 45%, Positives = 45/77 58%, Gaps = 12/77 15%
Query  40   QQFFASRQPRPQQL-FVQERPQQVFVQQQPQP---PVFVQPE-PQQ-VFVQPQPRPMF-Q 92
            QQ+F   QP PQQ  F+Q+ P+Q + QQQP P   P   QP+ P+Q  F Q  P+  F Q
Sbjct  19   QQLFPQWQPLPQQPPFLQQEPEQPYPQQQPLPQQQPFPQQPQLPHQHQFPQQLPQQQFPQ 78
Query  93   MLP-----SFSQQAAVIQSVQPQVSSACP 116
             +P      F QQ  +    QPQ     P
Sbjct  79   QMPLQPQQQFPQQMPLQPQQQPQFPQQKP 107

Sequence Alignment: 11. Allergen Name: Tri a glutenin Sequence ID: CAA31685

 Score = 39.0 bits 159,  Expect = 0.0002
 Identities = 33/69 47%, Positives = 44/69 63%, Gaps = 10/69 14%
Query  39   RQQFFASRQPRPQQ-LFVQERPQQVFVQQ----QPQPPVFVQPEPQQVFVQPQPRPMFQM 93
            +QQ +  +Q  PQQ LF Q++ QQ+F QQ    Q QPP F Q +P   F Q Q  P++  
Sbjct  34   QQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPP-FWQQQPP--FSQQQ--PILPQ 88
Query  94   LPSFSQQAAVIQSVQPQVS 112
             P FSQQ  ++   QP  S
Sbjct  89   QPPFSQQQQLVLPQQPPFS 107

Sequence Alignment: 12. Allergen Name: Tri a 21.0101 Sequence ID: CAY54134

 Score = 38.5 bits 156,  Expect = 0.0003
 Identities = 36/67 53%, Positives = 42/67 62%, Gaps = 11/67 16%
Query  37   GQRQQFF-ASRQPRPQQLFVQERPQ-QVFVQQQPQPPVFVQP-EPQQVFVQPQPR-PMFQ 92
            GQ+QQ F   +QP P Q   Q  PQ Q F+ Q P P    QP  PQQ + QPQP+ P  Q
Sbjct  32   GQQQQHFPGQQQPFPPQ---QPYPQPQPFLPQLPYPQ--PQPFPPQQSYPQPQPQYPQPQ 86
Query  93   MLPSFSQQAAVIQSVQPQ 110
              P  SQQ A +Q  Q Q
Sbjct  87   Q-P-ISQQQAQLQQQQQQ 102

Sequence Alignment: 13. Allergen Name: Tri a gliadin Sequence ID: AAA34276

 Score = 38.1 bits 154,  Expect = 0.0004
 Identities = 33/70 47%, Positives = 42/70 60%, Gaps = 9/70 12%
Query  38   QRQQFFASRQPRP-QQLFVQERP---QQVFVQQQPQP-PVFVQPEPQQVFVQPQPRPMFQ 92
            Q QQF   +QP P QQ + Q +P   QQ ++Q QP P P +  P+PQ  F   QP P  Q
Sbjct  46   QEQQFQGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQP-FRPQQPYPQPQ 104
Query  93   MLPSFSQ-QAAVIQSVQPQ 110
              P +SQ Q  + Q  Q Q
Sbjct  105  --PQYSQPQQPISQQQQQQ 121

Sequence Alignment: 14. Allergen Name: Tri a 36.0101 Sequence ID: AEH31546

 Score = 38.3 bits 156,  Expect = 0.0004
 Identities = 31/71 43%, Positives = 38/71 53%, Gaps = 9/71 12%
Query  44   ASRQPRPQQLFVQERPQQVFVQQQPQPPVFVQPEP-----QQVFVQPQPRPMFQMLPSFS 98
            + +QP P Q  +    QQ  +QQQPQP  F Q +P     QQ + Q Q  P  Q  P FS
Sbjct  33   SQQQPLPPQQTLSHHQQQQPIQQQPQP--FSQQQPCSQQQQQPLSQQQQPPFSQQQPPFS 90
Query  99   QQAA--VIQSVQPQVSSACP 116
            QQ    + Q  QP  S   P
Sbjct  91   QQQQQPLSQQQQPPFSQQQP 110

Sequence Alignment: 15. Allergen Name: Tri a glutenin Sequence ID: CAA59340

 Score = 37.8 bits 152,  Expect = 0.0005
 Identities = 54/162 33%, Positives = 81/162 50%, Gaps = 23/162 14%
Query  18   QSRFSYDGTPLADDVVVGSGQRQ-QFFASRQPRPQQ---LFVQERP--QQV--FVQQQPQ 69
            Q  FS    P+       S Q+Q QF   +QP PQQ   L++Q+ P  QQ   F QQQ Q
Sbjct  61   QPPFSQQELPILPQQPPFSQQQQPQFSQQQQPFPQQQQPLLLQQPPFSQQRPPFSQQQQQ 120
Query  70   PPVFVQPEPQQVFVQPQPRPMFQMLPSFS-QQAAVIQSVQPQVSSACPATYSLVHTTYQG 128
            P +  QP   Q   Q Q +P++   P FS +Q  V+   Q Q+    P   S+++     
Sbjct  121  PVLPQQPPFSQ---QQQQQPILPQQPPFSLHQQPVLP--QQQIPYVQP---SILQQLNPC 172
Query  129  RVYHSSWCNLPGHRFSQSAARDYCRGLGEVTVMNRRGSFDLYSVDRTTDFD----YFFEL 184
            +V+    C+ P     QS AR          VM ++    L  +   + +D      + +
Sbjct  173  KVFLQQQCS-PVA-MPQSLARSQMLWQSSCHVMQQQCCQQLPRIPEQSRYDAIRAIIYSI 230
Query  185  LLQHQ 189
            +LQ Q
Sbjct  231  VLQEQ 235

Sequence Alignment: 16. Allergen Name: Tri a gliadin Sequence ID: AAA34283

 Score = 36.8 bits 147,  Expect = 0.001
 Identities = 35/68 51%, Positives = 44/68 64%, Gaps = 13/68 19%
Query  37   GQRQQFFASRQPRPQQLFVQERP-QQVFVQQQPQPPVFVQPE-----PQQVFVQPQPR-P 89
            GQ++QF   +QP P+Q   Q  P QQ + Q QP PP +  P+     PQQ + QPQP+ P
Sbjct  53   GQQEQF-PPQQPYPHQ---QPFPSQQPYPQPQPFPPQLPYPQTQPFPPQQPYPQPQPQYP 108
Query  90   MFQMLPSFSQQAAVIQSVQPQ 110
              Q  P  SQQ A  Q  Q Q
Sbjct  109  QPQQ-P-ISQQQAQQQQQQQQ 127

Sequence Alignment: 17. Allergen Name: Tri a gliadin Sequence ID: AAA34282

 Score = 35.1 bits 138,  Expect = 0.003
 Identities = 35/73 47%, Positives = 47/73 64%, Gaps = 10/73 13%
Query  38   QRQQFFASRQPRP-QQLFVQERP---QQVFVQQQPQP-PVFVQPEPQQVFVQPQP-RPMF 91
            Q+QQF   +QP P QQ + Q++P   QQ ++Q QP P P +  P+PQ  + QPQP RP  
Sbjct  46   QQQQFPGQQQPFPPQQPYPQQQPFPSQQPYMQLQPFPQPQLPYPQPQLPYPQPQPFRPQQ 105
Query  92   ---QMLPSFSQ-QAAVIQSVQPQ 110
               Q  P +SQ Q  + Q  Q Q
Sbjct  106  SYPQPQPQYSQPQQPISQQQQQQ 128

Sequence Alignment: 18. Allergen Name: Tri a gliadin Sequence ID: AAA34285

 Score = 34.5 bits 135,  Expect = 0.005
 Identities = 48/141 34%, Positives = 69/141 48%, Gaps = 25/141 17%
Query  40   QQFFASRQPRPQQLFVQERPQQ-VFVQQQP----QPPVFVQPEP---QQVFVQPQPRPMF 91
            QQ F+ + P  QQ   Q  PQQ  F QQQP    Q P++ Q  P   QQ  V PQ  P  
Sbjct  41   QQSFSQQPPFSQQQ-QQPLPQQPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFS 99
Query  92   Q----MLPSFSQQAAVIQSVQPQVSSACPATYSLVHTTYQGRVYHSSWCNLPGHRFSQSA 147
            Q    +LP   QQ    Q VQ Q+    P   S+++     +V+    C+ P     Q  
Sbjct  100  QQQQLVLPPQQQQQ---QLVQQQIPIVQP---SVLQQLNPCKVFLQQQCS-PVA-MPQRL 151
Query  148  ARDYCRGLGEVTVMNRRGSFDLYSVDRTTDFD----YFFELLLQHQ 189
            AR          VM ++    L  +   + ++      + ++LQ Q
Sbjct  152  ARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRAIIYSIILQEQ 197

Sequence Alignment: 19. Allergen Name: Tri a glutenin Sequence ID: CAA44473

 Score = 34.4 bits 134,  Expect = 0.005
 Identities = 48/140 34%, Positives = 65/140 46%, Gaps = 20/140 14%
Query  40   QQFFASRQPRPQQLFVQERPQQ-VFVQQQPQPPVFVQPEPQQVF-VQPQPRPMFQ----M 93
            QQ F  + P  QQ   Q  PQQ  F QQQP  P    P PQQ   V PQ  P  Q    +
Sbjct  41   QQTFPQQPPFSQQQQQQPFPQQPSFSQQQPILPQG-PPFPQQTQPVLPQQSPFSQQQQLI 99
Query  94   LPSFSQQAAVIQSVQPQVSSACPATYSLVHTTYQGRVYHSSWCNLPGHRFSQSAARDYCR 153
            LP   QQ    Q  Q Q+S   P   S+++     +V+    C+ P     Q  AR    
Sbjct  100  LPPQQQQ----QLPQQQISIVQP---SVLQQLNPCKVFLQQQCS-PVA-IPQRLARSQMW 150
Query  154  GLGEVTVMNRRGSFDLYSVDRTTDFDYF----FELLLQHQ 189
                  VM ++    L  +   + +D      + ++LQ Q
Sbjct  151  QQSSCHVMQQQCCQQLSQIPEQSRYDAIRAITYSIILQEQ 190

Sequence Alignment: 20. Allergen Name: Tri a gliadin Sequence ID: AAA34281

 Score = 34.2 bits 133,  Expect = 0.005
 Identities = 33/73 45%, Positives = 45/73 61%, Gaps = 10/73 13%
Query  38   QRQQFFASRQPRP-QQLFVQERP---QQVFVQQQP--QPPV-FVQPEP---QQVFVQPQP 87
            Q+QQF+  +QP P QQ + Q +P   QQ ++Q QP  QP + + QP+P   QQ + QPQP
Sbjct  46   QQQQFLGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPYPQPQP 105
Query  88   RPMFQMLPSFSQQAAVIQSVQPQ 110
            +      P   QQ    Q  Q Q
Sbjct  106  QYSQPQQPISQQQQQQQQQQQQQ 128

Sequence Alignment: 21. Allergen Name: Tri a gliadin Sequence ID: AAA17741

 Score = 34.2 bits 133,  Expect = 0.006
 Identities = 33/73 45%, Positives = 45/73 61%, Gaps = 10/73 13%
Query  38   QRQQFFASRQPRP-QQLFVQERP---QQVFVQQQP--QPPV-FVQPEP---QQVFVQPQP 87
            Q+QQF+  +QP P QQ + Q +P   QQ ++Q QP  QP + + QP+P   QQ + QPQP
Sbjct  46   QQQQFLGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPYPQPQP 105
Query  88   RPMFQMLPSFSQQAAVIQSVQPQ 110
            +      P   QQ    Q  Q Q
Sbjct  106  QYSQPQQPISQQQQQQQQQQQQQ 128

Sequence Alignment: 22. Allergen Name: Tri a glutenin Sequence ID: CAA30570

 Score = 33.8 bits 132,  Expect = 0.01
 Identities = 32/65 49%, Positives = 39/65 60%, Gaps = 7/65 10%
Query  38   QRQQFFASRQPRPQQLFVQERPQQVFVQQQPQPPVFVQPEPQQVFVQPQPRPMFQMLPSF 97
            Q+QQ   S+Q +P   F Q++ Q  F QQQ QPP F Q + QQ   Q QP    Q  P F
Sbjct  103  QQQQPPYSQQQQPP--FSQQQ-QPPFSQQQQQPP-FTQQQQQQ--QQQQPFTQ-QQQPPF 155
Query  98   SQQAAVIQSVQP 109
            SQQ  + Q  QP
Sbjct  156  SQQPPISQQQQP 167

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.