The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV
HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL
DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY
NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND
IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA
LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL
YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNGAE
Sequence Info Allergen Name Length Opt Bits Score E Value
ADE74975 Asp v 13.0101 403 2579 594.2 3.5e-171
P28296 Asp f 13 403 2050 473.6 6.9e-135
CAA35594 Asp o 13 403 1972 455.9 1.6e-129
AAD47202 Asp fl protease 403 1967 454.7 3.4e-129
AAD25926 Pen c 13.0101 397 974 228.4 4.6e-61
AAF23726 Pen ch 13 397 971 227.7 7.4e-61
AAD52013 Tri r 2.0101 412 784 185.1 5.3e-48
AAF71379 Pen ch 18 494 705 167.0 1.7e-42
Q32ZM1 Rho m 2.0101 342 687 163.0 1.9e-41
ACF19589 Cur l 4.0101 506 466 112.5 4.4e-26
A0A0F6N3V8 Alt a 15.0101 507 458 110.7 1.6e-25
ABQ59329 Cla c 9.0101 388 446 108.0 7.7e-25
AAG44478 Pen o 18 503 439 106.4 3.1e-24
AAX14379 Cla h 9.0101 518 434 105.2 7.1e-24
Y13338 Asp f 18.0101 495 421 102.3 5.3e-23
A0A0U1Y1N5 Fus p 9.0101 386 404 98.5 5.8e-22
BAA06905 Cuc m 1 731 157 42.0 0.00011
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Asp v 13.0101 Sequence ID: ADE74975

 Score = 594.2 bits 2579,  Expect = 3e-171
 Identities = 403/403 100%, Positives = 403/403 100%, Gaps = 0/403 0%
Query  1    MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV 60
            MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV
Sbjct  1    MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV 60
Query  61   HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL 120
            HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL
Sbjct  61   HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL 120
Query  121  DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY 180
            DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY
Sbjct  121  DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY 180
Query  181  NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND 240
            NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND
Sbjct  181  NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND 240
Query  241  IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA 300
            IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA
Sbjct  241  IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA 300
Query  301  LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL 360
            LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL
Sbjct  301  LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL 360
Query  361  YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNGAE 403
            YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNGAE
Sbjct  361  YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNGAE 403

Sequence Alignment: 2. Allergen Name: Asp f 13 Sequence ID: P28296

 Score = 473.6 bits 2050,  Expect = 7e-135
 Identities = 312/401 77%, Positives = 349/401 87%, Gaps = 0/401 0%
Query  1    MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV 60
            M SIKRT+LLLGA+LPAVFGAP+ E RR  +K+PGKYIVTFK G     I++HT WA+++
Sbjct  1    MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL 60
Query  61   HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL 120
            HKRNLERRD T  +   GIEK++KI  FAAY GSFDDATIEEIR   DVAHVEEDQ+WYL
Sbjct  61   HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL 120
Query  121  DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY 180
            DALTTQ  APWGLG+ISH+G AS+DYIYDTSAGA TYAYVVD+GINV+H EF+ RASLAY
Sbjct  121  DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY 180
Query  181  NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND 240
            NAAGG HVDS+GHGTHVAGTIGGKT+GV+KK NLLSVKVF+GESSSTSIILDG+NWA ND
Sbjct  181  NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND 240
Query  241  IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA 300
            IVSK RT K+AIN+SLGGGYSYAF+NAVE+AFDEGVLSVVAAGNEN DASNTSPASAPNA
Sbjct  241  IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA 300
Query  301  LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL 360
            LTVAA  + NARASFSNYG VVDIFAPG+DILSAWIG  +ATNTISGTSMATPHIVGLS+
Sbjct  301  LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV 360
Query  361  YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNG 401
            YL+ LE LS P  VT+RIKELAT G ++ V GSPN LAYNG
Sbjct  361  YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNG 401

Sequence Alignment: 3. Allergen Name: Asp o 13 Sequence ID: CAA35594

 Score = 455.9 bits 1972,  Expect = 2e-129
 Identities = 296/401 73%, Positives = 348/401 86%, Gaps = 0/401 0%
Query  1    MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV 60
            M SIKRT+LLLGA+LPAV+GAP+ E RR  EK+PGKYIVTFK G+   +I  HTTWA+N+
Sbjct  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
Query  61   HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL 120
            H+R+LERR  T  DL  GIE+N+KI+KFAAY GSFDDATIEEIR ++DVA+VEEDQ++YL
Sbjct  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
Query  121  DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY 180
            D LTTQ  APWGLG+ISH+G  S+DYIYDTSAG  TYAYVVD+G+NVDH EF+GRAS AY
Sbjct  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
Query  181  NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND 240
            NAAGGQHVDS+GHGTHV+GTI GKT+G++KKA++LSVKVF+GESSSTS+ILDG+NWAAND
Sbjct  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
Query  241  IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA 300
            IVSK RT K+AIN+SLGGGYS AF++AVE+AF++GVLSVVAAGNEN DA  TSPASAP+A
Sbjct  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
Query  301  LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL 360
            +TVAA  + N RASFSN+G+VVD+FAPG+DILSAWIG +SATNTISGTSMATPHIVGLSL
Sbjct  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
Query  361  YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNG 401
            YL ALE L  P  VT RIKELAT+  +  V GSPN LAYNG
Sbjct  361  YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNG 401

Sequence Alignment: 4. Allergen Name: Asp fl protease Sequence ID: AAD47202

 Score = 454.7 bits 1967,  Expect = 3e-129
 Identities = 295/401 73%, Positives = 348/401 86%, Gaps = 0/401 0%
Query  1    MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV 60
            M SIKRT+LLLGA+LPAV+GAP+ E RR  EK+PGKYIVTFK G+   +I  HTTWA+N+
Sbjct  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
Query  61   HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL 120
            H+R+LERR  T  DL  GIE+N+KI+KFAAY GSFDDATIEEIR ++DVA+VEEDQ++YL
Sbjct  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
Query  121  DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY 180
            D LTTQ  APWGLG+ISH+G  S+DYIYDTSAG  TYAYVVD+G+NVDH EF+GRAS AY
Sbjct  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
Query  181  NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND 240
            NAAGGQHVDS+GHGTHV+GTI GKT+G++KKA++LSVKVF+GESSSTS+ILDG+NWAAND
Sbjct  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
Query  241  IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA 300
            IVSK RT K+AIN+SLGGGYS AF++AVE+AF++GVLSVVAAGNEN DA  TSPASAP+A
Sbjct  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
Query  301  LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL 360
            +TVAA  + N RASFSN+G+VVD+FAPG+DILSAWIG +SATNTISGTSMATPHIVGLSL
Sbjct  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
Query  361  YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNG 401
            YL ALE L  P  VT RI+ELAT+  +  V GSPN LAYNG
Sbjct  361  YLAALENLDGPAAVTKRIEELATKDVVKDVKGSPNLLAYNG 401

Sequence Alignment: 5. Allergen Name: Pen c 13.0101 Sequence ID: AAD25926

 Score = 228.4 bits 974,  Expect = 5e-61
 Identities = 162/381 42%, Positives = 232/381 60%, Gaps = 10/381 2%
Query  13   ALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVHKRNLERRDLTD 72
            A L  V    +L A      +P  YIV     +   + + H  WA+NVH R L RR   +
Sbjct  12   ATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFNTHREWATNVHAR-LSRRK--N 68
Query  73   RDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYLDALTTQSDAP-W 131
             +  PG  K+F+I+ +  Y  SFD++T ++I N   V ++E D +    A   QS+ P W
Sbjct  69   GETGPG--KHFEINGLKGYTASFDESTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSW 126
Query  132  GLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSV 191
            GL  IS +   ++ Y YD++AG     Y VDTGI++ HS+F GRA    N     + D  
Sbjct  127  GLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGN 186
Query  192  GHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAANDIVSKSRTGKS 250
            GHGTH A T  G  +GV+KKA L++VKV+  + S T S ++ G +WA  D  S+   GK 
Sbjct  187  GHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKY 246
Query  251  AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERN 310
             +N+SLGG +S A ++A  +    G++  VAAGNE  +ASN+SPASA    T+AAST  +
Sbjct  247  VMNMSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEVCTIAASTSTD 306
Query  311  ARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIALEGLSS 370
              ASF+N+G VVD++APG+ I +A+ GG S   T+SGTSMA PH+ G++ YL+ALEG+S+
Sbjct  307  GSASFTNFGSVVDLYAPGQSITAAYPGGGS--KTLSGTSMAAPHVAGVAAYLMALEGVSA 364
Query  371  PGDVTSRIKELATQGALSGVSGSPNALAYNG 401
             G+  +RI +LAT       SG+ + L YNG
Sbjct  365  -GNACARIVQLATSSISRAPSGTTSKLLYNG 394

Sequence Alignment: 6. Allergen Name: Pen ch 13 Sequence ID: AAF23726

 Score = 227.7 bits 971,  Expect = 7e-61
 Identities = 163/381 42%, Positives = 230/381 60%, Gaps = 10/381 2%
Query  13   ALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVHKRNLERRDLTD 72
            A L  V    +L A      +P  YIV     +   +   H  WA+NVH R L RR   +
Sbjct  12   ATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVHAR-LSRRK--N 68
Query  73   RDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYLDALTTQSDAP-W 131
             +  PG  K+F+I+ +  Y  SFD+ T ++I N   V ++E D +    A   QS+ P W
Sbjct  69   GETGPG--KHFEINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSW 126
Query  132  GLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSV 191
            GL  IS +   ++ Y YD++AG     Y VDTGI++ HS+F GRA    N     + D  
Sbjct  127  GLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGN 186
Query  192  GHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAANDIVSKSRTGKS 250
            GHGTH A T  G  +GV+KKA L++VKV+  + S T S ++ G +WA  D  S+   GK 
Sbjct  187  GHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKY 246
Query  251  AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERN 310
             +N SLGG +S A ++A  +    G++  VAAGNE  +ASN+SPASA  A T+AAST  +
Sbjct  247  VMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTD 306
Query  311  ARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIALEGLSS 370
              ASF+N+G VVD++APG+ I +A+ GG S   T+SGTSMA PH+ G++ YL+ALEG+S+
Sbjct  307  GSASFTNFGSVVDLYAPGQSITAAYPGGGS--KTLSGTSMAAPHVAGVAAYLMALEGVSA 364
Query  371  PGDVTSRIKELATQGALSGVSGSPNALAYNG 401
             G+  +RI +LAT       SG+ + L YNG
Sbjct  365  -GNACARIVQLATSSISRAPSGTTSKLLYNG 394

Sequence Alignment: 7. Allergen Name: Tri r 2.0101 Sequence ID: AAD52013

 Score = 185.1 bits 784,  Expect = 5e-48
 Identities = 173/398 43%, Positives = 242/398 60%, Gaps = 16/398 4%
Query  1    MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV 60
            M  I + I ++ A L  V GA ILEA  + E +P KYIV  K  +  E  +AHTTW S  
Sbjct  1    MGFITKAIPIVLAALSTVNGARILEAGPHAEAIPNKYIVVMKREVSDEAFNAHTTWLSQS 60
Query  61   HKRNLERRDLTDRDLYPGIEKNFKIHK-FAAYVGSFDDATIEEIRNHKDVAHVEEDQVWY 119
                + RR  + + +  G++  + +   F AY G FDDA I++I +H DV  +E D V  
Sbjct  61   LNSRIMRRAGSSKPM-AGMQDKYSLGGIFRAYSGEFDDAMIKDISSHDDVDFIEPDFVVR 119
Query  120  LDA----LTTQSDAP-WGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDG 174
                   LT Q + P WGL  +  +    + Y YD SAG    AY++DTGI++DH +F G
Sbjct  120  TTTNGTNLTHQDNVPSWGLARVGSKKPGGTTYYYDPSAGKGVTAYIIDTGIDIDHEDFQG 179
Query  175  RASLAYNAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESS-STSIILDG 233
            RA    N    Q+ D  GHGTHVAGT+GG  +G++K  +L++VKV++ + S S S ++ G
Sbjct  180  RAKWGENFVDQQNTDCNGHGTHVAGTVGGTKYGLAKGVSLVAVKVLDCDGSGSNSGVIKG 239
Query  234  YNWAANDIV-----SKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVD 288
              WA          +    GKS +N+SLGG  S A + A ++  D G++  VAAGNEN+D
Sbjct  240  MEWAMRQASGGGNGTAKAAGKSVMNMSLGGPRSEASNQAAKAISDAGIFMAVAAGNENMD 299
Query  289  ASNTSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGT 348
            A ++SPAS P+  TVAAST+ + +A FSNYG VVD++APG+DI S   GG+  T+T+SGT
Sbjct  300  AQHSSPASEPSVCTVAASTKDDGKADFSNYGAVVDVYAPGKDITSLKPGGS--TDTLSGT 357
Query  349  SMATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNGA 402
            SMA+PH+ GL  YLI L     PG +   IK++A     S   G+   L YNG+
Sbjct  358  SMASPHVCGLGAYLIGLGKQGGPG-LCDTIKKMANDVIQSPGEGTTGKLIYNGS 410

Sequence Alignment: 8. Allergen Name: Pen ch 18 Sequence ID: AAF71379

 Score = 167.0 bits 705,  Expect = 2e-42
 Identities = 174/380 45%, Positives = 237/380 62%, Gaps = 31/380 8%
Query  21   APILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVHKRNLERRDLTDRDLYP--- 77
            APIL +   ++ +P  YIV FK  +      AH +W   VH  +  R +L  R L+    
Sbjct  29   APIL-SSMTSKDIPDSYIVVFKKHVDPSSASAHQSWLQEVHTAHTGRMELKKRSLFGFDF 87
Query  78   ----GIEKNFKIH-KFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYLDALTTQSDAPW 131
                G++  F I   +  Y G F +  IE+IR H DV ++E+D +V  +   + + +APW
Sbjct  88   EAFMGLKHTFHIAGSLLGYAGHFHEDVIEQIRRHPDVDYIEKDSEVRTMSEGSVEKNAPW 147
Query  132  GLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQ- 186
            GL  ISH+   S    + Y+Y    G    AYV+DTG NV H +F+GRA+       G  
Sbjct  148  GLARISHRESLSFGNFNKYLYAEEGGEGVDAYVIDTGANVKHVDFEGRANWGKTIPQGDA 207
Query  187  HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAANDIVSKS 245
              D  GHGTH +GTI GK FGV+KKAN+ +VKV+    S T S ++ G  WAA   + KS
Sbjct  208  DEDGNGHGTHCSGTIAGKKFGVAKKANVYAVKVLRSNGSGTMSDVVKGVEWAAEAHIKKS 267
Query  246  RTGK-----SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA 300
            + G      S  N+SLGGG S  +  AV +A D G+   VAAGN+N DA N SPA+A  A
Sbjct  268  KKGDKKFKGSVANMSLGGGSSRTLDLAVNAAVDAGIHFAVAAGNDNADACNYSPAAAEKA 327
Query  301  LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL 360
            +TV AST  + RA FSNYG+  DIFAPG +ILS W+G + ATNTISGTSMA+PHI GL  
Sbjct  328  ITVGASTLADERAYFSNYGKCTDIFAPGLNILSTWVGSDHATNTISGTSMASPHIAGLLA 387
Query  361  YLIAL----EGLSSPGDVTSR-----IKELATQGALSGV-SGSPNALAYNG 401
            Y ++L    +   +  DVT +     +  +AT+G L+ + S +PN LA+NG
Sbjct  388  YYVSLAPAKDSAYAVADVTPKQLKAALISVATEGTLTDIPSDTPNLLAWNG 438

Sequence Alignment: 9. Allergen Name: Rho m 2.0101 Sequence ID: Q32ZM1

 Score = 163.0 bits 687,  Expect = 2e-41
 Identities = 141/302 46%, Positives = 195/302 64%, Gaps = 23/302 7%
Query  100  IEEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDAS----SDYIYDTSAGAD 155
            IE++R    V  +E++ + + + +T    APWGL  ISH+   S      Y+YD++ G  
Sbjct  9    IEQVRQLPMVNFIEKNSLVHANEFTVAKGAPWGLARISHRDPLSLGSFDQYLYDSNGGTG 68
Query  156  TYAYVVDTGINVDHSEFDGRASLAYNAA-GGQHVDSVGHGTHVAGTIGGKTFGVSKKANL 214
              +YV+DTG+NV H +F+GRA        G +  D  GHGTH AGTIG   +GV+K A +
Sbjct  69   VTSYVIDTGVNVHHEQFEGRAKWGKTIPQGDEDEDGNGHGTHCAGTIGSNAYGVAKNAEI 128
Query  215  LSVKVFEGESS-STSIILDGYNWAAN---DIVSKSRTGKSAINLSLGGGYSYAFSNAVES 270
            ++VKV+    S S S ++ G  +A     D V K +   S  N+SLGGG S A+  AV +
Sbjct  129  VAVKVLRSNGSGSMSDVIKGVEFAVKSHQDSVKKGKNSFSTANMSLGGGKSPALDLAVNA 188
Query  271  AFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGED 330
            A   G+   VAAGNEN DA NTSPASA NA+TV AST  +ARA FSNYG+ VDIFAPG +
Sbjct  189  AVKAGLHFAVAAGNENQDACNTSPASAENAITVGASTISDARAYFSNYGKCVDIFAPGLN 248
Query  331  ILSAWIGGNSATNTISGTSMATPHIVGLSLYLIAL------------EGLSSPGDVTSRI 378
            ILS +IG ++AT  +SGTSMA+PHI GL  Y ++L            EG++ P  +   +
Sbjct  249  ILSTYIGSDAATAYLSGTSMASPHIAGLLTYYLSLQPSSDSEFFIGAEGIT-PAQLKKNL 307
Query  379  KELATQGALSGV-SGSPNALAYNGA 402
              + T   L+ + + +PN LA+NGA
Sbjct  308  IAFGTPDVLADIPADTPNILAFNGA 332

Sequence Alignment: 10. Allergen Name: Cur l 4.0101 Sequence ID: ACF19589

 Score = 112.5 bits 466,  Expect = 4e-26
 Identities = 176/378 46%, Positives = 243/378 64%, Gaps = 40/378 10%
Query  21   APILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVHKRNL-ERRDLTDR--DL-- 75
            AP+L +    E VP  Y+V FK   + +    H  W  +VH +N  ER +L  R  DL  
Sbjct  29   APVLSSTSAKE-VPNSYMVVFKK--HVKDASKHHDWVQSVHSKNTQERMELRKRSSDLPV 85
Query  76   ----YPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYL--DALTTQSD 128
                + G++  +++  +  Y G FDD T+E IRNH DV ++E D +V  L  D   T+++
Sbjct  86   SNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENN 145
Query  129  APWGLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAG 184
            +PWGL  ISH+   S    + Y+Y    G     YV+DTG NVDH +F+GRA        
Sbjct  146  SPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPN 205
Query  185  GQ-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAA---N 239
            G    D  GHGTH +GT+ GK +GV+KKA++ +VKV+    S T S ++ G  +AA   +
Sbjct  206  GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHS 265
Query  240  DIVSKSRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTS 293
            + VS ++ GK      S  N+SLGGG S  +  AV +A D G+   VAAGN+N D+ N S
Sbjct  266  EAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYS 325
Query  294  PASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATP 353
            PA+A NA+TV AST  + RA FSNYG+  DIFAPG +ILS WIG   ATNTISGTSMA+P
Sbjct  326  PAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASP 385
Query  354  HIVGLSLYLIALEGLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNG 401
            HI GL  Y+++L+            +P  + + +  + T GALS V S + N LA+NG
Sbjct  386  HIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNG 443

Sequence Alignment: 11. Allergen Name: Alt a 15.0101 Sequence ID: A0A0F6N3V8

 Score = 110.7 bits 458,  Expect = 2e-25
 Identities = 170/369 46%, Positives = 234/369 63%, Gaps = 39/369 10%
Query  31   EKVPGKYIVTFKSGLQAEQIDAHTTWASNVH-KRNLERRDLTDR--------DLYPGIEK 81
            ++VP  Y+V FK   + +    H  W  +VH K N ER +L  R        +++ G++ 
Sbjct  9    KEVPNSYMVVFKK--HVKDASKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKH 66
Query  82   NFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYL--DALTTQSDAPWGLGAISH 138
             +++     Y G FDD TIE IRNH DV ++E D +V  L  D    + ++PWGL  ISH
Sbjct  67   VYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPWGLARISH 126
Query  139  QGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQ-HVDSVGH 193
            +   S    + Y+Y    G     YV+DTG N  H +F+GRA        G    D  GH
Sbjct  127  RDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGH 186
Query  194  GTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAA---NDIVSKSRTGK 249
            GTH +GT+ GK +GV+KKA++ +VKV+    S T S ++ G  +AA   +D V  ++ GK
Sbjct  187  GTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGK 246
Query  250  ------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNALTV 303
                  SA N+SLGGG S  +  AV +A D G+   VAAGN+N D+ N SPA+A NA+TV
Sbjct  247  KKGFKGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTV 306
Query  304  AASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLI 363
             AST  + RA FSNYG+  DIFAPG +ILS WIG   ATNTISGTSMA+PHI GL  Y++
Sbjct  307  GASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYML 366
Query  364  ALEGLS---------SPGDVTSRIKELATQGALSGVS-GSPNALAYNG 401
            +L+            +P  + + +  +AT GALS V   + N LA+NG
Sbjct  367  SLQPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNG 414

Sequence Alignment: 12. Allergen Name: Cla c 9.0101 Sequence ID: ABQ59329

 Score = 108.0 bits 446,  Expect = 8e-25
 Identities = 137/276 49%, Positives = 181/276 65%, Gaps = 25/276 9%
Query  126  QSDAPWGLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYN 181
            + +APWGL  ISH+   S    + Y+Y    G     YVVDTG NVDH +F+GRAS    
Sbjct  14   EKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKT 73
Query  182  AAGGQ-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESS-STSIILDGYNWAAN 239
               G    D  GHGTH +GT+ GK +GV+KKA++ +VKV+    S S S ++ G  +AA 
Sbjct  74   IPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAE 133
Query  240  ---DIVSKSRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDAS 290
               + VS ++ GK      S  N+SLGGG S  +  AV +A D G+   VAAGN+N D+ 
Sbjct  134  SHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSC 193
Query  291  NTSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM 350
            N SPA+A NA+TV AST  + RA FSNYG+  DIFAPG +I S WIG   A NTISGTSM
Sbjct  194  NYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSM 253
Query  351  ATPHIVGLSLYLIALEGLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYN 400
            A+PH+ GL  YL++L+            SP  + + +  +AT GAL+ V S + N LA+N
Sbjct  254  ASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWN 313
Query  401  G 401
            G
Sbjct  314  G 314

Sequence Alignment: 13. Allergen Name: Pen o 18 Sequence ID: AAG44478

 Score = 106.4 bits 439,  Expect = 3e-24
 Identities = 177/381 46%, Positives = 241/381 63%, Gaps = 35/381 9%
Query  20   GAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVHKRNLERRDLTDRDLY--- 76
            GA  L +    +++P  YIV FK  + A    AH +W  ++H  N+ R +L  R L+   
Sbjct  27   GAAPLISSTSAKEIPDSYIVVFKKHVGASAASAHHSWVQDIHSDNV-RMELKKRSLFGFE 85
Query  77   --P--GIEKNFKIH-KFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYLDALTTQSDAP 130
              P  G++  F +   +  Y G F +  IE++R H DV ++E+D +V +++    + +AP
Sbjct  86   SEPYLGVKHTFHVAGSLMGYAGHFHEDVIEQVRRHPDVEYIEKDSEVHHFEDPAIEKNAP 145
Query  131  WGLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAA-GG 185
            WGL  ISH+   S    + Y+Y    G    AYV+DTG NVDH +F+GRAS       G 
Sbjct  146  WGLARISHRDSLSFGSFNKYLYAEDGGEGVDAYVIDTGTNVDHVDFEGRASWGKTIPQGD 205
Query  186  QHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAANDIVSK 244
            Q VD  GHGTH +GTI GK +GV+KKAN+ +VKV+    S T S ++ G  WAA   + K
Sbjct  206  QDVDGNGHGTHCSGTIAGKKYGVAKKANVYAVKVLRSNGSGTMSDVVKGVEWAAEAHIKK 265
Query  245  SRTGK---------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPA 295
            S+  K         S  N+SLGGG S  +  AV +A D G+   VAAGN+N DA N SPA
Sbjct  266  SKAAKDGKAKGFKGSVANMSLGGGSSRTLDLAVNAAVDAGMHFAVAAGNDNADACNYSPA 325
Query  296  SAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHI 355
            +A  A+TV AST  + RA FSNYG+  DIFAPG +ILS WIG   A NTISGTSMA+PHI
Sbjct  326  AAEKAVTVGASTLADERAYFSNYGKCTDIFAPGLNILSTWIGSKYAVNTISGTSMASPHI 385
Query  356  VGLSLYLIALEGLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNG 401
             GL  Y ++L+  S         +P  +   +  +AT GALS + S +PN LA+NG
Sbjct  386  AGLLAYYVSLQPASDSAYAVEEITPKKLKDALITIATSGALSDIPSDTPNLLAWNG 441

Sequence Alignment: 14. Allergen Name: Cla h 9.0101 Sequence ID: AAX14379

 Score = 105.2 bits 434,  Expect = 7e-24
 Identities = 171/380 45%, Positives = 235/380 61%, Gaps = 37/380 9%
Query  21   APILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVH-KRNLERRDLTDR------ 73
            API+ A    E +   Y++ FK  +       H  W  ++H K  + + +L  R      
Sbjct  29   APIISASNAKE-IADNYMIKFKDHVTQNLAAEHHGWVQDLHEKTQVAKTELRKRSQSPMV 87
Query  74   -DLYPGIEKNFKIHK-FAAYVGSFDDATIEEIRNHKDVAHVEEDQ-VWYLDALT-TQSDA 129
             D++ G++  + I   +  Y G FD+  IE+IR H DV  VE DQ V  L + +  + +A
Sbjct  88   DDIFNGLKHTYNIAGGLMGYAGHFDEDVIEQIRRHPDVELVERDQEVHVLGSESEVEKNA 147
Query  130  PWGLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGG 185
            PWGL  ISH+   S    + Y+Y    G     YVVDTG NVDH +F+GRAS       G
Sbjct  148  PWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKTIPQG 207
Query  186  Q-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESS-STSIILDGYNWAAN---D 240
                D  GHGTH +GT+ GK +GV+KKA++ +VKV+    S S S ++ G  +AA    +
Sbjct  208  DADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAESHLE 267
Query  241  IVSKSRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSP 294
             VS ++ GK      S  N+SLGGG S  +  AV +A D G+   VAAGN+N D+ N SP
Sbjct  268  QVSITKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSCNYSP 327
Query  295  ASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPH 354
            A+A NA+TV AST  + RA FSNYG+  DIFAPG +I S WIG   A NTISGTSMA+PH
Sbjct  328  AAAENAVTVGASTLADERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSMASPH 387
Query  355  IVGLSLYLIALEGLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNG 401
            + GL  YL++L+            SP  + + +  +AT GAL+ V S + N LA+NG
Sbjct  388  VAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWNG 444

Sequence Alignment: 15. Allergen Name: Asp f 18.0101 Sequence ID: Y13338

 Score = 102.3 bits 421,  Expect = 5e-23
 Identities = 176/380 46%, Positives = 238/380 62%, Gaps = 35/380 9%
Query  21   APILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVHKRNLERRDLTDRDL----- 75
            APIL +    E VP  YIV FK  + AE   AH +W  ++H    ER +L  R L     
Sbjct  29   APILSSMNAKE-VPDSYIVVFKKHVNAESAAAHHSWVQDIHSAQNERVELRKRSLFGFGE 87
Query  76   --YPGIEKNFKIH-KFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYLDALTTQSDAPW 131
              Y G++  F I   +  Y G F +  IE++R H DV ++E+D +V  ++  T +  APW
Sbjct  88   EAYLGLKNTFDIAGSLVGYSGHFHEDVIEQVRKHPDVEYIEKDSEVHTMEDPTVEKSAPW 147
Query  132  GLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNA-AGGQ 186
            GL  ISH+   S    + Y+Y +  G    AY +DTGINVDH +F+GRA          +
Sbjct  148  GLARISHRDSLSFGTFNKYLYASEGGEGVDAYTIDTGINVDHVDFEGRAQWGKTIPTDDE 207
Query  187  HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAANDIVSK- 244
              D  GHGTH +GTI G+ +GV+KKANL +VKV+    S T S ++ G  WA    + K 
Sbjct  208  DADGNGHGTHCSGTIAGRKYGVAKKANLYAVKVLRSSGSGTMSDVVAGVEWAVKSHLKKV 267
Query  245  --SRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPAS 296
              ++ GK      S  N+SLGGG S  +  AV +  + G+   VAAGN+N DA N SPA+
Sbjct  268  KDAKDGKIKGFKGSVANMSLGGGKSRTLEAAVNAGVEAGLHFAVAAGNDNADACNYSPAA 327
Query  297  APNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIV 356
            A N +TV AST ++ RA FSNYG+  DIFAPG +ILS WIG   A NTISGTSMA+PHI 
Sbjct  328  AENPITVGASTLQDERAYFSNYGKCTDIFAPGLNILSTWIGSKHAVNTISGTSMASPHIA 387
Query  357  GLSLYLIALEGLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNG 401
            GL  Y+++L+            +P  +   I  +ATQGAL+ + S +PN LA+NG
Sbjct  388  GLLAYFVSLQPSKDSAFAVDELTPKKLKKDIIAIATQGALTDIPSDTPNLLAWNG 442

Sequence Alignment: 16. Allergen Name: Fus p 9.0101 Sequence ID: A0A0U1Y1N5

 Score = 98.5 bits 404,  Expect = 6e-22
 Identities = 134/277 48%, Positives = 180/277 64%, Gaps = 25/277 9%
Query  125  TQSDAPWGLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY 180
            T+  APWGL  ISH+   +    + Y+Y +  G    AY+VDTG NVDH +F+GRA    
Sbjct  7    TERQAPWGLARISHRNTLNFGTFNKYLYSSDGGEGVDAYIVDTGTNVDHVDFEGRAHWGK 66
Query  181  NAAGGQ-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESS-STSIILDGYNWAA 238
                G    D  GHGTH +GT+ GK +GV+KKAN+ +VKV+    S S S ++ G  +AA
Sbjct  67   TIPSGDADEDGNGHGTHCSGTVAGKKYGVAKKANVYAVKVLRSNGSGSMSDVVKGVEFAA 126
Query  239  NDIV---SKSRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDA 289
               +    K++ GK      S  N+SLGGG + A+  AV +A   G+   VAAGN+N DA
Sbjct  127  TSHLEQKKKAKDGKRKGFKGSVANMSLGGGKTQALDAAVNAAVRTGIHFAVAAGNDNADA 186
Query  290  SNTSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTS 349
             N SPA+A   +TV AS   ++RA FSNYG+  DIFAPG +I S WIG   A NTISGTS
Sbjct  187  CNYSPAAASEPVTVGASALDDSRAYFSNYGKCTDIFAPGLNIQSTWIGSKYAVNTISGTS 246
Query  350  MATPHIVGLSLYLIALE-------GLSS--PGDVTSRIKELATQGALSGV-SGSPNALAY 399
            MA+PHI GL  Y ++L+        L+S  P  +   +  +AT+ ALS + S +PN LA+
Sbjct  247  MASPHIAGLLAYYLSLQPAEDSEYALASITPKKLKENLISVATEDALSDIPSDTPNLLAW 306
Query  400  NG 401
            NG
Sbjct  307  NG 308

Sequence Alignment: 17. Allergen Name: Cuc m 1 Sequence ID: BAA06905

 Score = 42.0 bits 157,  Expect = 0.0001
 Identities = 68/236 28%, Positives = 117/236 49%, Gaps = 36/236 15%
Query  123  LTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNA 182
            +TT S +PW L   +   D    ++     G +  ++    G++++   FD +    Y  
Sbjct  313  FTTASLSPWLLSVAASTMDRK--FVTQVQIG-NGQSF---QGVSIN--TFDNQ---YYPL 361
Query  183  AGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESS-STSIILDGYNWAANDI 241
              G+ + + G     +     K    S   NLL  K+   E+S      +   + AA  +
Sbjct  362  VSGRDIPNTGFDKSTSRFCTDK----SVNPNLLKGKIVVCEASFGPHEFFKSLDGAAG-V 416
Query  242  VSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNAL 301
            +  S T   A +  L    S    N + + +   + S+ + G     ++    ASAP  +
Sbjct  417  LMTSNTRDYADSYPLPS--SVLDPNDLLATL-RYIYSIRSPGATIFKSTTILNASAP--V 471
Query  302  TVAASTERNARASFSNYGEVV--DIFAPGEDILSAW-----IGG---NSATNTISGTSMA 351
             V+ S+    RA+     +V+  DI  PG +IL+AW     +GG   N+  N ISGTSM+
Sbjct  472  VVSFSSRGPNRAT----KDVIKPDISGPGVEILAAWPSVAPVGGIRRNTLFNIISGTSMS 527
Query  352  TPHIVGLSLYLIALEGLSSPGDVTSRIKELAT 383
             PHI G++ Y+       SP  + S +   A+
Sbjct  528  CPHITGIATYVKTYNPTWSPAAIKSALMTTAS 559

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.