The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

NLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVDQIIAIATDYL
ANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIPH
IPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQS
IVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIP
VDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDF
LNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLA
LYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLTH
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD13530 Bla g 1.0101 412 2597 598.3 2.1e-172
AAD13531 Bla g 1.02 492 1992 460.4 8.6e-131
AAB82404 Per a 1.0103 395 1711 396.4 1.3e-111
AAC34736 Per a 1.0201 446 1374 319.5 1.9e-88
AAD13532 Bla g 1.0103 188 1193 278.6 1.7e-76
AAC34312 Per a 1.0102 228 991 232.5 1.6e-62
AAD13533 Per a 1.0101 231 987 231.6 3.1e-62
AAC34737 Per a 1.0104 274 965 226.5 1.2e-60
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bla g 1.0101 Sequence ID: AAD13530

 Score = 598.3 bits 2597,  Expect = 2e-172
 Identities = 412/412 100%, Positives = 412/412 100%, Gaps = 0/412 0%
Query  1    NLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVDQIIAIATDYL 60
            NLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVDQIIAIATDYL
Sbjct  1    NLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVDQIIAIATDYL 60
Query  61   ANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIPH 120
            ANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIPH
Sbjct  61   ANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIPH 120
Query  121  IPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQS 180
            IPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQS
Sbjct  121  IPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQS 180
Query  181  IVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIP 240
            IVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIP
Sbjct  181  IVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIP 240
Query  241  VDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDF 300
            VDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDF
Sbjct  241  VDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDF 300
Query  301  LNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLA 360
            LNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLA
Sbjct  301  LNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLA 360
Query  361  LYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLTH 412
            LYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLTH
Sbjct  361  LYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLTH 412

Sequence Alignment: 2. Allergen Name: Bla g 1.02 Sequence ID: AAD13531

 Score = 460.4 bits 1992,  Expect = 9e-131
 Identities = 301/404 74%, Positives = 365/404 90%, Gaps = 8/404 1%
Query  1    NLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVDQIIAIATDYL 60
            NL++KL++KGVDVD IIELI  +F +    + +R L +DLQDFLALIP DQ++AIA DYL
Sbjct  89   NLIQKLKDKGVDVDHIIELIHQIFNIV---RDTRGLPEDLQDFLALIPTDQVLAIAADYL 145
Query  61   ANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIPH 120
            ANDAEV+AAV YL+SDEFETIVV +D+LPE++NFLNFL+ NGLNAI+FLN IHDLLGIPH
Sbjct  146  ANDAEVKAAVEYLKSDEFETIVVTVDSLPEFKNFLNFLQTNGLNAIEFLNNIHDLLGIPH 205
Query  121  IPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQS 180
            IPV+GRK H+RRGVGITGLIDD++AILP++DL ALF EKLETSP+F ALY+AIRSPEFQS
Sbjct  206  IPVTGRK-HLRRGVGITGLIDDIIAILPVDDLYALFQEKLETSPEFKALYDAIRSPEFQS 264
Query  181  IVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIP 240
            IV+TL AMPEYQ+L+QKL++KGVDVD IIELI  +F +    + +R L +DLQDFLALIP
Sbjct  265  IVETLKAMPEYQSLIQKLKDKGVDVDHIIELIHQIFNIV---RDTRGLPEDLQDFLALIP 321
Query  241  VDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDF 300
            +DQI+AIA DYLANDAEVQAAV YL+SDEFETIVVT+D+LPE++NFLNFL+ NGLNAI+F
Sbjct  322  IDQILAIAADYLANDAEVQAAVEYLKSDEFETIVVTVDSLPEFKNFLNFLQTNGLNAIEF 381
Query  301  LNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLA 360
            +N IHDLLGIPHIP +GRK H+RRGVGI GLIDDV+AILP+D+L ALF EKLE+SP+F A
Sbjct  382  INNIHDLLGIPHIPATGRK-HVRRGVGINGLIDDVIAILPVDELYALFQEKLESSPEFKA 440
Query  361  LYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLTH 412
            LY+AI+SPEFQSIVQTL AMPEYQ+L+++L++KGVDVD  IELI+ LFGL+H
Sbjct  441  LYDAIRSPEFQSIVQTLKAMPEYQDLIQRLKDKGVDVDHFIELIKKLFGLSH 492
 Score = 114.4 bits 474,  Expect = 1e-26
 Identities = 72/88 81%, Positives = 81/88 92%, Gaps = 1/88 1%
Query  104  NAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETS 163
            NAI+FLN IHDLLGIPHIPV+ RK+H RRGVGITGLIDD++AILP++DL ALF EKLETS
Sbjct  1    NAIEFLNNIHDLLGIPHIPVTARKHH-RRGVGITGLIDDIIAILPVDDLYALFQEKLETS 59
Query  164  PDFLALYNAIRSPEFQSIVQTLNAMPEYQ 192
            P+F ALY+AIRSPEFQSIV TL AMPEYQ
Sbjct  60   PEFKALYDAIRSPEFQSIVGTLEAMPEYQ 88

Sequence Alignment: 3. Allergen Name: Per a 1.0103 Sequence ID: AAB82404

 Score = 396.4 bits 1711,  Expect = 1e-111
 Identities = 268/390 68%, Positives = 327/390 83%, Gaps = 9/390 2%
Query  15   KIIELIRALFGLTLNAK-ASRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYL 73
            K+  +I A++G+ +     +RNLQDDL DFLAL+PVD+I AI  DYLANDAEVQ AVAYL
Sbjct  2    KLPIMILAVLGVAFGKSLPNRNLQDDLNDFLALLPVDEITAIVMDYLANDAEVQEAVAYL 61
Query  74   QSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGI-PHIPVSGRKYHIRR 132
            Q +EF  IV  ++ L E+ NF+ FLE +GL+A+ ++N +H ++G  P++P S RK H RR
Sbjct  62   QGEEFHKIVFTVEGLQEFGNFVQFLEDHGLDAVGYINRLHSVFGWDPYVPSSKRK-HTRR 120
Query  133  GVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQSIVQTLNAMPEYQ 192
            GVG+ GLIDD++AILPI+DLKALF EKLETSPDF A+Y+A+RSPEFQSIVQTLNAMPEYQ
Sbjct  121  GVGVDGLIDDIIAILPIDDLKALFQEKLETSPDFKAFYDAVRSPEFQSIVQTLNAMPEYQ 180
Query  193  NLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIPVDQIIAIATDYL 252
            +LLQKLR+KGVDVD  IELIRALFGLT   +A+RNLQDDL DFLALIP DQI+AIA DYL
Sbjct  181  DLLQKLRDKGVDVDHYIELIRALFGLT---RAARNLQDDLNDFLALIPTDQILAIAMDYL 237
Query  253  ANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIP- 311
            ANDAEVQ  VAYLQSD+F  I+ T++ALPE+ NF NFL+ +GL+  D++N IH ++G+P 
Sbjct  238  ANDAEVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVADYINEIHSIIGLPP 297
Query  312  HIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLALYNAIKSPEFQ 371
             +P S R  H RRGVGI GLIDDV+AILP+D+LKALF EKLETSPDF ALY+AI+SPEFQ
Sbjct  298  FVPPSRR--HARRGVGINGLIDDVIAILPVDELKALFQEKLETSPDFKALYDAIRSPEFQ 355
Query  372  SIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGL 410
            SI+ TLNAMPEYQ LL+ LR+K VDVD  IELIR+LFGL
Sbjct  356  SIISTLNAMPEYQELLQNLRDKAVDVDHFIELIRSLFGL 394

Sequence Alignment: 4. Allergen Name: Per a 1.0201 Sequence ID: AAC34736

 Score = 319.5 bits 1374,  Expect = 2e-88
 Identities = 222/350 63%, Positives = 279/350 79%, Gaps = 16/350 4%
Query  4    EKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFL-ALIPVDQIIAIATDYLAN 62
            + LR+KGVDVD  I+LIRALFGL+   +A+RNLQDDL DFL +L P+          L  
Sbjct  86   QNLRDKGVDVDHFIQLIRALFGLS---RAARNLQDDLNDFLHSLEPIS---PRHRHGLPR 139
Query  63   DAEVQAAV-AYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIP-H 120
                 A V AYL++D+F  I+  ++ALPE+ NF NFL+ +GL+ +D++N IH ++G+P  
Sbjct  140  QRRRSARVSAYLHADDFHKIITTIEALPEFANFYNFLKEHGLDVVDYINEIHSIIGLPPF 199
Query  121  IPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQS 180
            +P S R  H RRGVGI GLIDDV+AILP+++LKALF EKLETSPDF ALY+AIRSPEFQS
Sbjct  200  VPPSRR--HARRGVGINGLIDDVIAILPVDELKALFQEKLETSPDFKALYDAIRSPEFQS 257
Query  181  IVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIP 240
            I+ TLNAMPEYQ LLQ LR+KGVDVD  I + +  +    +G+  RNLQDDL DFLALIP
Sbjct  258  IISTLNAMPEYQELLQNLRDKGVDVDHFIRVDQGTLRTLSSGQ--RNLQDDLNDFLALIP 315
Query  241  VDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDF 300
             DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ALPE+ NF NFL+ +GL+ +D+
Sbjct  316  TDQILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEALPEFANFYNFLKEHGLDVVDY 375
Query  301  LNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFL 359
            +N IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+LKALF EKLETSPDF 
Sbjct  376  INEIHSIIGLPPFVPPSQR--HARRGVGINGLIDDVIAILPVDELKALFQEKLETSPDFK 433
Query  360  ALYNAI 365
            ALY+AI
Sbjct  434  ALYDAI 439
 Score = 88.8 bits 362,  Expect = 5e-19
 Identities = 57/78 73%, Positives = 68/78 87%, Gaps = 3/78 3%
Query  109  LNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFL 167
            +N IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+++LKALF EKLETSPDF 
Sbjct  1    INEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDELKALFQEKLETSPDFK 58
Query  168  ALYNAIRSPEFQSIVQTLNAM 188
            ALY+AIRSPEFQSI+ TLNAM
Sbjct  59   ALYDAIRSPEFQSIISTLNAM 79

Sequence Alignment: 5. Allergen Name: Bla g 1.0103 Sequence ID: AAD13532

 Score = 278.6 bits 1193,  Expect = 2e-76
 Identities = 188/188 100%, Positives = 188/188 100%, Gaps = 0/188 0%
Query  225  SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 284
            SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ
Sbjct  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
Query  285  NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 344
            NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL
Sbjct  61   NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 120
Query  345  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 404
            KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI
Sbjct  121  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 180
Query  405  RALFGLTH 412
            RALFGLTH
Sbjct  181  RALFGLTH 188

Sequence Alignment: 6. Allergen Name: Per a 1.0102 Sequence ID: AAC34312

 Score = 232.5 bits 991,  Expect = 2e-62
 Identities = 167/226 73%, Positives = 196/226 86%, Gaps = 6/226 2%
Query  180  SIVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALI 239
            SI+ TLNAMPEYQ+LLQ LR+KGVDVD  IELIRALFGLT   +A+RNLQDDL DFLALI
Sbjct  1    SIISTLNAMPEYQDLLQNLRDKGVDVDHYIELIRALFGLT---RAARNLQDDLNDFLALI 57
Query  240  PVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAID 299
            P DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ LPE+ NF NFL+ +GL+  D
Sbjct  58   PTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEGLPEFANFYNFLKEHGLDVAD 117
Query  300  FLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDF 358
            FLN IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+LKALF+EKLETSPDF
Sbjct  118  FLNEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDELKALFDEKLETSPDF 175
Query  359  LALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGL 410
             ALY+AI+SPEFQSI+ TLNAMPEYQ+LL+ LR+KGVDVD  IELIR+LFGL
Sbjct  176  KALYDAIRSPEFQSIISTLNAMPEYQDLLQNLRDKGVDVDHFIELIRSLFGL 227

Sequence Alignment: 7. Allergen Name: Per a 1.0101 Sequence ID: AAD13533

 Score = 231.6 bits 987,  Expect = 3e-62
 Identities = 170/229 74%, Positives = 197/229 86%, Gaps = 6/229 2%
Query  177  EFQSIVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFL 236
            EFQSI+ TLNAMPEYQ LLQ LR+KGVDVD  IELIRALFGLT   +A+RNLQDDL DFL
Sbjct  1    EFQSIISTLNAMPEYQELLQNLRDKGVDVDHYIELIRALFGLT---RAARNLQDDLNDFL 57
Query  237  ALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLN 296
            ALIP DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ LPE+ NF NFL+ +GL+
Sbjct  58   ALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEGLPEFANFYNFLKEHGLD 117
Query  297  AIDFLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETS 355
              DFLN IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+LKALF EKLETS
Sbjct  118  VADFLNEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDELKALFQEKLETS 175
Query  356  PDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGL 410
            PDF ALY+AI+SPEFQSI+ TLNAMPEYQ+LL+ LR+KGVDVD  IELIR+LFGL
Sbjct  176  PDFKALYDAIRSPEFQSIISTLNAMPEYQDLLQNLRDKGVDVDHFIELIRSLFGL 230

Sequence Alignment: 8. Allergen Name: Per a 1.0104 Sequence ID: AAC34737

 Score = 226.5 bits 965,  Expect = 1e-60
 Identities = 200/272 73%, Positives = 236/272 86%, Gaps = 6/272 2%
Query  134  VGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQSIVQTLNAMPEYQN 193
            VG+ GLIDD++AILPI+DLKALF EKLETS DF A+Y+A+RSPEFQSIVQTLNAMPEYQ+
Sbjct  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
Query  194  LLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIPVDQIIAIATDYLA 253
            LLQKLR+KGVDVD  IELIRALFGLT   + +RNLQDDL DFLALIP DQI+AIA DYLA
Sbjct  61   LLQKLRDKGVDVDHYIELIRALFGLT---REARNLQDDLNDFLALIPTDQILAIAMDYLA 117
Query  254  NDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIP-H 312
            NDAEVQ  VAYLQSD+F  I+ T++ALPE+ NF NFL+ +GL+  +++N IH ++G+P  
Sbjct  118  NDAEVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPF 177
Query  313  IPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLALYNAIKSPEFQS 372
            +P S R  H RRGVGI GLIDDV+AILP+D+LK LF EKLETSPDF ALY+AI+SPEFQS
Sbjct  178  VPPSRR--HARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQS 235
Query  373  IVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGL 410
            I+ TLNAMPEYQ LL+ LR+KGVDVD  IELIR+ FGL
Sbjct  236  IISTLNAMPEYQELLQNLRDKGVDVDHFIELIRSWFGL 273

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.