The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC
GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV
ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDP
Sequence Info Allergen Name Length Opt Bits Score E Value
AAG34078 Cap a 1 180 1412 304.6 1.1e-84
CAC34055 Cap a 1w 246 1225 265.1 1.1e-72
Q9ARG0 Cap a 1.0101 246 1225 265.1 1.1e-72
P12670 Lyc e NP24 247 1190 257.8 1.8e-70
P81370 Act c 2 225 927 202.4 7.7e-54
1Z3Q_A Mus a 4.0101 200 921 201.2 1.6e-53
E3SU11 Ole e 13.0101 226 919 200.7 2.5e-53
P81295 Jun a 3 225 662 146.6 4.8e-37
AAR21074 Cup s 3.0102 225 648 143.7 3.7e-36
AAR21073 Cup s 3.0101 225 648 143.7 3.7e-36
CAC05258 Cup a 3 199 638 141.6 1.4e-35
ACE80955 Pru p 2.0301 242 429 97.5 3.1e-22
CAC10270 Mal d 2 246 418 95.2 1.6e-21
P50694 Pru av 2 245 405 92.5 1e-20
ACE80959 Pru p 2.0101 246 392 89.7 7e-20
ACE80957 Pru p 2.0201 246 383 87.8 2.6e-19
AAF80165 Jun v 3.010102 97 331 77.2 1.6e-16
AAF80167 Jun v 3.010101 97 331 77.2 1.6e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cap a 1 Sequence ID: AAG34078

 Score = 304.6 bits 1412,  Expect = 1e-84
 Identities = 180/180 100%, Positives = 180/180 100%, Gaps = 0/180 0%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC
Sbjct  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV
Sbjct  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDP 180
            ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDP
Sbjct  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDP 180

Sequence Alignment: 2. Allergen Name: Cap a 1w Sequence ID: CAC34055

 Score = 265.1 bits 1225,  Expect = 1e-72
 Identities = 154/179 86%, Positives = 167/179 93%, Gaps = 0/179 0%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            NNCPYTVWAA+TPVGGG+RL+RGQ+W   APPGT MARIWGRTNCNFDG+GRG CQTGDC
Sbjct  28   NNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGSCQTGDC 87
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GGVL+C GWGKPPNTLAEYALNQF+NLDFWDIS++DGFNIPM+F PT P  GKCH IQC 
Sbjct  88   GGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKCHAIQCT 147
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDD 179
            ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPT+LS+FFK+RCPDAYSYPQDD
Sbjct  148  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDD 206

Sequence Alignment: 3. Allergen Name: Cap a 1.0101 Sequence ID: Q9ARG0

 Score = 265.1 bits 1225,  Expect = 1e-72
 Identities = 154/179 86%, Positives = 167/179 93%, Gaps = 0/179 0%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            NNCPYTVWAA+TPVGGG+RL+RGQ+W   APPGT MARIWGRTNCNFDG+GRG CQTGDC
Sbjct  28   NNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGSCQTGDC 87
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GGVL+C GWGKPPNTLAEYALNQF+NLDFWDIS++DGFNIPM+F PT P  GKCH IQC 
Sbjct  88   GGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKCHAIQCT 147
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDD 179
            ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPT+LS+FFK+RCPDAYSYPQDD
Sbjct  148  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDD 206

Sequence Alignment: 4. Allergen Name: Lyc e NP24 Sequence ID: P12670

 Score = 257.8 bits 1190,  Expect = 2e-70
 Identities = 149/180 82%, Positives = 165/180 91%, Gaps = 0/180 0%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            NNCPYTVWAA+TP+GGG+RL RGQ+W   AP GTKMARIWGRT CNF+ AGRG CQTGDC
Sbjct  28   NNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGTCQTGDC 87
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GGVL+C GWGKPPNTLAEYAL+QFSNLDFWDIS++DGFNIPM+F PTKP  GKCH I+C 
Sbjct  88   GGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCT 147
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDP 180
            ANINGECP +L+VPGGCNNPCTTFGGQQYCCTQGPCGPT+LS+FFK+RCPDAYSYPQDDP
Sbjct  148  ANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDP 207

Sequence Alignment: 5. Allergen Name: Act c 2 Sequence ID: P81370

 Score = 202.4 bits 927,  Expect = 8e-54
 Identities = 121/175 69%, Positives = 142/175 81%, Gaps = 5/175 2%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            NNCP+TVWAAA P GGGKRL+RGQ+W      GTK AR+W RT CNFDGAGRG CQTGDC
Sbjct  31   NNCPFTVWAAAVP-GGGKRLDRGQNWIINPGAGTKGARVWPRTGCNFDGAGRGKCQTGDC 89
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKC-HPIQC 119
             G+L+C+ +G+PPNTLAEYALNQF+NLDF+DIS++DGFN+ M F PT    G C   I+C
Sbjct  90   NGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVDGFNVAMEFSPTS---GGCTRGIKC 146
Query  120  VANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDD 179
             A+ING+CP  LR PGGCNNPCT F   QYCC  G CG T++S+FFK RCPDAYSYP+DD
Sbjct  147  TADINGQCPNELRAPGGCNNPCTVFKTDQYCCNSGNCGLTNFSKFFKDRCPDAYSYPKDD 206

Sequence Alignment: 6. Allergen Name: Mus a 4.0101 Sequence ID: 1Z3Q_A

 Score = 201.2 bits 921,  Expect = 2e-53
 Identities = 118/175 67%, Positives = 138/175 78%, Gaps = 4/175 2%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            N C YTVWAAA P GGG++L +GQSW      GT   RIWGRT C+FDG+GRG CQTGDC
Sbjct  7    NRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQTGDC 65
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GGVL C  +G PPNTLAE+ALNQF+NLDF+DIS++DGFN+PM F PT    G C  I+C 
Sbjct  66   GGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTS---GGCRGIRCA 122
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDD 179
            A+ING+CPG+L+ PGGCNNPCT F   QYCC  G C PTD S+FFK+ CPDAYSYP+DD
Sbjct  123  ADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPKDD 181

Sequence Alignment: 7. Allergen Name: Ole e 13.0101 Sequence ID: E3SU11

 Score = 200.7 bits 919,  Expect = 2e-53
 Identities = 122/176 69%, Positives = 139/176 78%, Gaps = 6/176 3%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            N C YTVWAAA+P GGG+RL++GQSW     PGT  ARIWGRTNCNFD  GRG C+TGDC
Sbjct  31   NQCTYTVWAAASP-GGGRRLDQGQSWNINVAPGTTQARIWGRTNCNFDANGRGQCETGDC 89
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
             G+LEC+G+G+PPNTLAE+ALNQ +NLDF DIS +DGFNIP+ F PT      C  + C 
Sbjct  90   NGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPLEFSPTT---NVCRRLVCN 146
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGP--CGPTDLSRFFKQRCPDAYSYPQD 178
            A I  +CP  LR PGGCNNPCT F   +YCCT GP  CGPT LSRFFK+RCPDAYSYPQD
Sbjct  147  APIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTPLSRFFKERCPDAYSYPQD 206
Query  179  DP 180
            DP
Sbjct  207  DP 208

Sequence Alignment: 8. Allergen Name: Jun a 3 Sequence ID: P81295

 Score = 146.6 bits 662,  Expect = 5e-37
 Identities = 92/172 53%, Positives = 113/172 65%, Gaps = 10/172 5%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            N C YTVWAA  P GGGKRL++GQ+W      GT  AR WGRT C FD +G+G CQTGDC
Sbjct  33   NQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQTGDC 91
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GG L C   G  P TLAEY     S+ D++D+S++DGFNIP++  PT     +C    C 
Sbjct  92   GGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTN---AQCTAPACK 145
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTDLSRFFKQRCPDAYSYPQ 177
            A+IN  CP  L+V GGCN+ C  F   QYCC       C  T+ S+ FK +CP AYSY +
Sbjct  146  ADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAK 205
Query  178  DD 179
            DD
Sbjct  206  DD 207

Sequence Alignment: 9. Allergen Name: Cup s 3.0102 Sequence ID: AAR21074

 Score = 143.7 bits 648,  Expect = 4e-36
 Identities = 90/172 52%, Positives = 113/172 65%, Gaps = 10/172 5%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            N C YTVWAA  P GGGKRL++GQ+W      GT  AR WGRT C FD +G+G C++GDC
Sbjct  33   NQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRSGDC 91
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GG L C   G  P TLAEY     S+ D++D+S++DGFNIP++  PT     KC    C 
Sbjct  92   GGQLSCTVSGAVPATLAEYTQ---SDKDYYDVSLVDGFNIPLAINPTNT---KCTAPACK 145
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTDLSRFFKQRCPDAYSYPQ 177
            A+IN  CP  L+V GGCN+ C  +   QYCC       C  T+ S+ FK +CP AYSY +
Sbjct  146  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAK 205
Query  178  DD 179
            DD
Sbjct  206  DD 207

Sequence Alignment: 10. Allergen Name: Cup s 3.0101 Sequence ID: AAR21073

 Score = 143.7 bits 648,  Expect = 4e-36
 Identities = 90/172 52%, Positives = 113/172 65%, Gaps = 10/172 5%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            N C YTVWAA  P GGGKRL++GQ+W      GT  AR WGRT C FD +G+G C++GDC
Sbjct  33   NQCRYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRSGDC 91
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GG L C   G  P TLAEY     S+ D++D+S++DGFNIP++  PT     KC    C 
Sbjct  92   GGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTNT---KCTAPACK 145
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTDLSRFFKQRCPDAYSYPQ 177
            A+IN  CP  L+V GGCN+ C  +   QYCC       C  T+ S+ FK +CP AYSY +
Sbjct  146  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAK 205
Query  178  DD 179
            DD
Sbjct  206  DD 207

Sequence Alignment: 11. Allergen Name: Cup a 3 Sequence ID: CAC05258

 Score = 141.6 bits 638,  Expect = 1e-35
 Identities = 88/172 51%, Positives = 112/172 65%, Gaps = 10/172 5%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            N C YTVWAA  P GGGK +++GQ+W      GT  AR WGRT C FD +G+G C++GDC
Sbjct  7    NQCGYTVWAAGLP-GGGKEFDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRSGDC 65
Query  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
            GG L C   G  P TLAEY     S+ D++D+S++DGFNIP++  PT     KC    C 
Sbjct  66   GGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTNT---KCTAPACK 119
Query  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTDLSRFFKQRCPDAYSYPQ 177
            A+IN  CP  L+V GGCN+ C  +   QYCC       C  T+ S+ FK +CP AYSY +
Sbjct  120  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVNNCPATNYSKIFKNQCPQAYSYAK 179
Query  178  DD 179
            DD
Sbjct  180  DD 181

Sequence Alignment: 12. Allergen Name: Pru p 2.0301 Sequence ID: ACE80955

 Score = 97.5 bits 429,  Expect = 3e-22
 Identities = 83/176 47%, Positives = 107/176 60%, Gaps = 21/176 11%
Query  1    NNCPYTVWAAA--TP--VGGGKRLERGQSWWFWAP-PGTKMARIWGRTNCNFDGAGRGWC 55
            NNCPYTVW A+   P     G  L    S+ +  P P +   R W RT C+ D +G+  C
Sbjct  30   NNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWS--GRFWARTRCSTDASGKFVC 87
Query  56   QTGDC-GGVLECKGW-GKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGK 113
            +T DC  G L C G  G PP TLAE+ +      DF+D+S++DGFN+PMS  P + G G 
Sbjct  88   ETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDVSLVDGFNLPMSVTP-QGGTGT 146
Query  114  CHPIQCVANINGECPGSLRVPGG------CNNPCTTFGGQQYCCT-----QGPCGPTDLS 162
            C    C AN+N  CP  L+  G       C + C  FG  QYCCT     +  C PT+ S
Sbjct  147  CKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGEPQYCCTPPQETKEKCPPTNYS 206
Query  163  RFFKQRCPDAYSYPQDD 179
            + F ++CPDAYSY  DD
Sbjct  207  QIFHEQCPDAYSYAFDD 223

Sequence Alignment: 13. Allergen Name: Mal d 2 Sequence ID: CAC10270

 Score = 95.2 bits 418,  Expect = 2e-21
 Identities = 78/176 44%, Positives = 105/176 59%, Gaps = 24/176 13%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAP--------PGTKMARIWGRTNCNFDGAGR 52
            NNCP TVW     + G ++ +   + +  A         P     R WGRT C+ D AG+
Sbjct  31   NNCPNTVWPGT--LTGDQKPQLSLTGFELASKASRSVDAPSPWSGRFWGRTRCSTDAAGK 88
Query  53   GWCQTGDCG-GVLECKGWGK-PPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPG 110
              C+T DCG G + C G G  PP TL E  +      D++D+S++DGFN+PMS  P + G
Sbjct  89   FTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDYYDVSLVDGFNLPMSVAP-QGG 147
Query  111  PGKCHPIQCVANINGECPGSLRVPGG------CNNPCTTFGGQQYCCT---QGP--CGPT 159
             G+C P  C AN+N  CP  L+V         C + C  FG  +YCCT     P  C PT
Sbjct  148  TGECKPSSCPANVNKVCPAPLQVKAADGSVISCKSACLAFGDSKYCCTPPNNTPETCPPT 207
Query  160  DLSRFFKQRCPDAYSYPQDD 179
            + S  F+++CP AYSY  DD
Sbjct  208  EYSEIFEKQCPQAYSYAYDD 227

Sequence Alignment: 14. Allergen Name: Pru av 2 Sequence ID: P50694

 Score = 92.5 bits 405,  Expect = 1e-20
 Identities = 78/178 43%, Positives = 97/178 54%, Gaps = 20/178 11%
Query  1    NNCPYTVWAAATPVGGGKRLER------GQSWWFWAPPGTKMARIWGRTNCNFDGAGRGW 54
            NNCPY VW          +L         Q+ +    P     R W RT C+ D +G+  
Sbjct  30   NNCPYMVWPGTLTSDQKPQLSTTGFELASQASFQLDTPVPWNGRFWARTGCSTDASGKFV 89
Query  55   CQTGDCG-GVLECKGWGK-PPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPG 112
            C T DC  G + C G G  PP TLAE+ +      DF+D+S++DGFN+PMS  P + G G
Sbjct  90   CATADCASGQVMCNGNGAIPPATLAEFNIPAGGGQDFYDVSLVDGFNLPMSVTP-QGGTG 148
Query  113  KCHPIQCVANINGECPGSLRVPGG------CNNPCTTFGGQQYCCT---QGP--CGPTDL 161
             C    C AN+N  CP  L+  G       C + C  FG  QYCCT     P  C PT+ 
Sbjct  149  DCKTASCPANVNAVCPSELQKKGSDGSVVACLSACVKFGTPQYCCTPPQNTPETCPPTNY 208
Query  162  SRFFKQRCPDAYSYPQDD 179
            S  F   CPDAYSY  DD
Sbjct  209  SEIFHNACPDAYSYAYDD 226

Sequence Alignment: 15. Allergen Name: Pru p 2.0101 Sequence ID: ACE80959

 Score = 89.7 bits 392,  Expect = 7e-20
 Identities = 84/175 48%, Positives = 105/175 60%, Gaps = 26/175 14%
Query  1    NNCPYTVWAAATPVGGGK--------RLERGQSWWFWAP-PGTKMARIWGRTNCNFDGAG 51
            N C YTVW   T  G  K        +L  G S    AP P +   R +GRT C+ D +G
Sbjct  31   NKCSYTVWPG-TLTGDQKPQLSLTGFKLATGISRSVDAPSPWS--GRFFGRTRCSTDASG 87
Query  52   RGWCQTGDCG-GVLECKGWGK-PPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKP 109
            +  C T DCG G + C G G  PP TL E  +      DF+D+S++DGFN+PMS  P + 
Sbjct  88   KFTCATADCGSGQVSCNGNGAAPPATLVEITIASNGGQDFYDVSLVDGFNLPMSVAP-QG 146
Query  110  GPGKCHPIQCVANINGECPGSLRVPGG------CNNPCTTFGGQQYCCT---QGP--CGP 158
            G GKC    C A+IN  CP  L+V G       C + C  F   +YCCT     P  C P
Sbjct  147  GTGKCKASTCPADINKVCPAPLQVKGSDGSVIACKSACLAFNQPKYCCTPPNDKPETCPP 206
Query  159  TDLSRFFKQRCPDAYSYPQDD 179
            TD S++FK +CP AYSY  DD
Sbjct  207  TDYSKLFKTQCPQAYSYAYDD 227

Sequence Alignment: 16. Allergen Name: Pru p 2.0201 Sequence ID: ACE80957

 Score = 87.8 bits 383,  Expect = 3e-19
 Identities = 83/175 47%, Positives = 105/175 60%, Gaps = 26/175 14%
Query  1    NNCPYTVWAAATPVGGGK--------RLERGQSWWFWAP-PGTKMARIWGRTNCNFDGAG 51
            N C YTVW   T  G  K         L  G S    AP P +   R +GRT C+ D +G
Sbjct  31   NKCSYTVWPG-TLTGDQKPQLSLTGFELATGISNSVDAPSPWS--GRFFGRTRCSTDASG 87
Query  52   RGWCQTGDCG-GVLECKGWGK-PPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKP 109
            +  C T DCG G + C G G  PP TL E  + +    DF+D+S++DGFN+PMS  P + 
Sbjct  88   KFTCATADCGSGQVSCNGNGAVPPATLVEITIAENGGQDFYDVSLVDGFNLPMSVAP-QG 146
Query  110  GPGKCHPIQCVANINGECPGSLRVPGG------CNNPCTTFGGQQYCCT---QGP--CGP 158
            G G+C    C A+IN  CP  L+V G       C + C  +   QYCCT     P  C P
Sbjct  147  GTGECKASTCPADINKVCPAELQVKGSDGSVIACKSACLALNQPQYCCTPPNDKPETCPP 206
Query  159  TDLSRFFKQRCPDAYSYPQDD 179
            TD S++FK +CP AYSY  DD
Sbjct  207  TDYSKLFKTQCPQAYSYAYDD 227

Sequence Alignment: 17. Allergen Name: Jun v 3.010102 Sequence ID: AAF80165

 Score = 77.2 bits 331,  Expect = 2e-16
 Identities = 47/78 60%, Positives = 52/78 66%, Gaps = 1/78 1%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            N C YTVWAA  P GGGKRL++GQ+W      GT  AR WGRT C FD +G+G CQTGDC
Sbjct  13   NQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQTGDC 71
Query  61   GGVLECKGWGKPPNTLAEY 79
            G  L C   G  P TLAEY
Sbjct  72   GRQLSCTVSGAVPATLAEY 90

Sequence Alignment: 18. Allergen Name: Jun v 3.010101 Sequence ID: AAF80167

 Score = 77.2 bits 331,  Expect = 2e-16
 Identities = 47/78 60%, Positives = 52/78 66%, Gaps = 1/78 1%
Query  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
            N C YTVWAA  P GGGKRL++GQ+W      GT  AR WGRT C FD +G+G CQTGDC
Sbjct  13   NQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQTGDC 71
Query  61   GGVLECKGWGKPPNTLAEY 79
            G  L C   G  P TLAEY
Sbjct  72   GRQLSCTVSGAVPATLAEY 90

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.