The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE
TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA
AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW
HKHYLVCNYGPSGNFQNEELYQTK
Sequence Info Allergen Name Length Opt Bits Score E Value
P35760 Ves m 5 204 1441 370.7 1.8e-104
P35783 Ves f 5 204 1387 357.0 2.3e-100
Q05110 Ves v 5 227 1380 355.2 8.8e-100
P35784 Ves g 5 204 1371 353.0 3.7e-99
P35785 Ves p 5 204 1356 349.2 5.1e-98
P35787 Ves vi 5 206 1109 286.9 3e-79
P35786 Ves s 5 205 1089 281.8 9.7e-78
Q05108 Dol a 5 203 1015 263.2 4e-72
P10737 Dol m 5.02 215 1005 260.6 2.5e-71
AAA28302 Dol m 5.02 212 998 258.9 8.3e-71
P10736 Dol m 5.0101 227 995 258.1 1.5e-70
P35781 Vesp c 5 202 993 257.6 1.9e-70
P81657 Vesp m 5 202 979 254.1 2.2e-69
P0DMB9 Vesp v 5.0101 202 976 253.3 3.6e-69
P35782 Vesp c 5 202 975 253.1 4.3e-69
P81656 Pol d 5 206 886 230.6 2.6e-62
Q7Z156 Poly s 5.0101 207 885 230.4 3.1e-62
P35780 Pol f 5 205 879 228.9 8.6e-62
P83377 Pol g 5 206 876 228.1 1.5e-61
C0HJV9 Poly p 5.0101 206 874 227.6 2.1e-61
P86686 Poly p 5.0102 207 868 226.1 6e-61
Q05109 Pol a 5 209 860 224.1 2.5e-60
P35759 Pol e 5.0101 205 856 223.1 4.8e-60
AAT95009 Pol e 5.0101 226 846 220.5 3.1e-59
C0ITL3 Pac c 3.0101 199 689 181.0 2.2e-47
P35779 Sol r 3 211 688 180.7 2.9e-47
P35778 Sol i 3 234 686 180.1 4.6e-47
QEA69430 Sco m 5.0101 210 386 104.5 2.4e-24
AAF65314 Cte f 2 264 299 82.4 1.3e-17
AAF82096 Glo m 5 259 265 73.9 5e-15
ABC58726 Sol s 3.0101 90 255 71.8 7.2e-15
AAY32926 Sol g 3.0101 70 245 69.4 3e-14
AVD29827 Art si 2.0101 163 200 57.7 2.3e-10
AVD29826 Art la 2.0101 163 200 57.7 2.3e-10
A0A2L1DGQ3 Art ar 2.0101 163 200 57.7 2.3e-10
AVD29822 Art an 2.0101 163 200 57.7 2.3e-10
AVD29824 Art ca 2.0101 163 200 57.7 2.3e-10
AVD29825 Art gm 2.0101 163 200 57.7 2.3e-10
ADM18345 Tab y 5.0101 256 194 56.0 1.2e-09
AAU15051 Cyn d 24.0101 153 190 55.2 1.2e-09
7065471 Pol m 5.0101 37 131 40.9 6e-06
XP_007199020 Pru p 9.0101 161 134 41.0 2.4e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 370.7 bits 1441,  Expect = 2e-104
 Identities = 204/204 100%, Positives = 204/204 100%, Gaps = 0/204 0%
Query  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE
Sbjct  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
            TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA
Sbjct  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
Query  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
            AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW
Sbjct  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
Query  181  HKHYLVCNYGPSGNFQNEELYQTK 204
            HKHYLVCNYGPSGNFQNEELYQTK
Sbjct  181  HKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 2. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 357.0 bits 1387,  Expect = 2e-100
 Identities = 194/204 95%, Positives = 199/204 97%, Gaps = 0/204 0%
Query  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            NNYCKIKCLKGGVHTACKYGSLKPNCGNK VVSYGLTKQEKQDILKEHNDFRQKIARGLE
Sbjct  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
            TRGNPGPQPPAKNMKNLVW+DELAY+AQVWANQCQYGHDTCRD+AKYQVGQNVALTGSTA
Sbjct  61   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDIAKYQVGQNVALTGSTA 120
Query  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
            A Y+DPVKLVKMWEDEVKDYNPKKKFS NNFLK GHYTQMVWANTKEVGCGSIK+IQE W
Sbjct  121  AKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQEKW 180
Query  181  HKHYLVCNYGPSGNFQNEELYQTK 204
            HKHYLVCNYGPSGNFQNEELYQTK
Sbjct  181  HKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 3. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 355.2 bits 1380,  Expect = 9e-100
 Identities = 194/204 95%, Positives = 198/204 97%, Gaps = 0/204 0%
Query  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            NNYCKIKCLKGGVHTACKYGSLKPNCGNK VVSYGLTKQEKQDILKEHNDFRQKIARGLE
Sbjct  24   NNYCKIKCLKGGVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLE 83
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
            TRGNPGPQPPAKNMKNLVW+DELAY+AQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA
Sbjct  84   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 143
Query  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
            A Y+DPVKLVKMWEDEVKDYNPKKKFS N+FLK GHYTQMVWANTKEVGCGSIKYIQE W
Sbjct  144  AKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQEKW 203
Query  181  HKHYLVCNYGPSGNFQNEELYQTK 204
            HKHYLVCNYGPSGNF NEELYQTK
Sbjct  204  HKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 4. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 353.0 bits 1371,  Expect = 4e-99
 Identities = 194/204 95%, Positives = 198/204 97%, Gaps = 0/204 0%
Query  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            NNYCKIKCLKGGVHTACKY SLKPNC NKKVV+YGLTKQEKQDILKEHNDFRQKIARGLE
Sbjct  1    NNYCKIKCLKGGVHTACKYESLKPNCANKKVVAYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
            TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKY VGQNVALTGSTA
Sbjct  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYPVGQNVALTGSTA 120
Query  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
            A Y++PVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ+ W
Sbjct  121  AKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQDKW 180
Query  181  HKHYLVCNYGPSGNFQNEELYQTK 204
            HKHYLVCNYGPSGNF NEELYQTK
Sbjct  181  HKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 5. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 349.2 bits 1356,  Expect = 5e-98
 Identities = 190/204 93%, Positives = 196/204 96%, Gaps = 0/204 0%
Query  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            NNYCKIKCLKGGVHTACKYGSLKPNCGNK VVSYGLTK+EKQDILKEHNDFRQKIARGLE
Sbjct  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARGLE 60
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
            TRGNPGPQPPAKNMKNLVW+DELAY+AQVWANQCQYGHDTCRDVAKY VGQNVALTGSTA
Sbjct  61   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYPVGQNVALTGSTA 120
Query  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
              Y++PVKLVKMWEDEVKDYNPKKKFSENNF KIGHYTQMVWANTKE+GCGSIKYIQ  W
Sbjct  121  DKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYIQNEW 180
Query  181  HKHYLVCNYGPSGNFQNEELYQTK 204
            HKHYLVCNYGPSGNF NEELYQTK
Sbjct  181  HKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 6. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 286.9 bits 1109,  Expect = 3e-79
 Identities = 149/203 73%, Positives = 177/203 87%, Gaps = 1/203 0%
Query  2    NYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            NYCKIKCLKGGVHTACKYG S KPNCG   V +YGLT+ EKQ+ILK HNDFRQK+A+GLE
Sbjct  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
            TRGNPGPQPPAKNM NLVW+DELA IAQVWA+QC YGHDTC+D  KY VGQN+A   +TA
Sbjct  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
Query  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
            A+++ P KLVKMWE+EVKD+NP  ++S+NN+ K GHYTQMVWA TKE+GCGS+KY+++ W
Sbjct  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
Query  181  HKHYLVCNYGPSGNFQNEELYQTK 204
            + HYLVCNYGPSGNF+NE+LY+ K
Sbjct  183  YTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 7. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 281.8 bits 1089,  Expect = 1e-77
 Identities = 147/203 72%, Positives = 173/203 85%, Gaps = 1/203 0%
Query  2    NYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            +YCKIKCLKGGVHTACKYG S KPNCGN  V SYG+T+ EKQ+ILK HNDFR K+ARGLE
Sbjct  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
            TRGNPGPQPPAKNM NLVW++ELA IAQ+WA+QC+YGHDTC+D  KY VGQN+A++ STA
Sbjct  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
Query  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
            AVY +   LVK WE+EVKD+NP   + +N F KIGHYTQMVWA TKE+GCGSIKY+  NW
Sbjct  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
Query  181  HKHYLVCNYGPSGNFQNEELYQTK 204
            + HYLVCNYGP+GNF N+E+Y+ K
Sbjct  182  YTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 8. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 263.2 bits 1015,  Expect = 4e-72
 Identities = 138/202 68%, Positives = 161/202 79%, Gaps = 3/202 1%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NNYCKI C KG  HT CKYG S+KPNCG K V SYG+T  EK +I+K HN+FRQK+A+GL
Sbjct  1    NNYCKI-CPKG-THTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGL 58
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            ETRGNPGPQPPAKNM  LVW+DELA IAQ WANQC +GHD CR+ AKY VGQNVA+  +T
Sbjct  59   ETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFGHDQCRNTAKYPVGQNVAIASTT 118
Query  120  AAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQEN 179
               Y     L+KMWEDEVKDYNP K +  NNF K+GHYTQMVW  TKE+GCGS+KYI+  
Sbjct  119  GNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIENK 178
Query  180  WHKHYLVCNYGPSGNFQNEELYQTK 204
            WH HYLVCNYGP+GN+ N+ +Y+ K
Sbjct  179  WHTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 9. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 260.6 bits 1005,  Expect = 2e-71
 Identities = 132/203 65%, Positives = 164/203 80%, Gaps = 3/203 1%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NNYCKIKC +G +HT CK+G S+KPNCG+K V  +G++  EK +I+  HN FRQK+A+GL
Sbjct  11   NNYCKIKCSRG-IHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            ETRGNPGPQPPAKNM  LVW+DELA IAQ WANQC +GHD CR+  KYQVGQNVA+  +T
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQVGQNVAIASTT 129
Query  120  AAVYNDPVKLVKMWEDEVKDYNPKK-KFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQE 178
               Y    KL++MWE+EVKD+NPKK    +NNF K+GHYTQMVW  TKE+GCGS+KYI+ 
Sbjct  130  GNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIEN 189
Query  179  NWHKHYLVCNYGPSGNFQNEELYQTK 204
            NWH HYLVCNYGP+GN+ ++ +Y+ K
Sbjct  190  NWHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 10. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 258.9 bits 998,  Expect = 8e-71
 Identities = 131/200 65%, Positives = 162/200 81%, Gaps = 3/200 1%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NNYCKIKC +G +HT CK+G S+KPNCG+K V  +G++  EK +I+  HN FRQK+A+GL
Sbjct  11   NNYCKIKCSRG-IHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            ETRGNPGPQPPAKNM  LVW+DELA IAQ WANQC +GHD CR+  KYQVGQNVA+  +T
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQVGQNVAIASTT 129
Query  120  AAVYNDPVKLVKMWEDEVKDYNPKK-KFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQE 178
               Y    KL++MWE+EVKD+NPKK    +NNF K+GHYTQMVW  TKE+GCGS+KYI+ 
Sbjct  130  GNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIEN 189
Query  179  NWHKHYLVCNYGPSGNFQNEELY 201
            NWH HYLVCNYGP+GN+ ++ +Y
Sbjct  190  NWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 11. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 258.1 bits 995,  Expect = 2e-70
 Identities = 133/203 65%, Positives = 162/203 79%, Gaps = 2/203 0%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NNYCKIKC KG +HT CK+G S+KPNCG   V +YGLT  EK +ILK HNDFRQ +A+GL
Sbjct  24   NNYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            ETRG PGPQPPAKNM  LVW+DELA IAQ WANQC + HD CR+ AKYQVGQN+A++ +T
Sbjct  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTT 142
Query  120  AAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQEN 179
            A  ++ P KL+K WEDEV ++N K  +  +NF K+GHYTQMVW  TKE+GCGSIKYI++N
Sbjct  143  ATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDN 202
Query  180  WHKHYLVCNYGPSGNFQNEELYQTK 204
            W+ HYLVCNYGP GN  N+ +Y+ K
Sbjct  203  WYTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 12. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 257.6 bits 993,  Expect = 2e-70
 Identities = 139/198 70%, Positives = 163/198 82%, Gaps = 10/198 5%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NNYCKIKC + G+HT CKYG S KPNCG   V + GLTKQE  +ILK+HN+FRQK+ARGL
Sbjct  1    NNYCKIKC-RSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            ETRGNPGPQPPAK+M  LVW+DELA IAQVWANQC YGHD CR+ AKY VGQN+A   +T
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTT 119
Query  120  AAVYNDPVKLVKMWEDEVKDY---NPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYI 176
            A  +     +VKMWEDEVKDY   +PK K++     K+GHYTQMVWA TKE+GCGSIKYI
Sbjct  120  ADNFGSVSNMVKMWEDEVKDYQYGSPKNKLN-----KVGHYTQMVWAKTKEIGCGSIKYI 174
Query  177  QENWHKHYLVCNYGPSGNFQNEELYQTK 204
            +  WH+HYLVCNYGP+GN  NE +Y+ K
Sbjct  175  ENGWHRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 13. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 254.1 bits 979,  Expect = 2e-69
 Identities = 133/201 66%, Positives = 162/201 80%, Gaps = 4/201 1%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NNYCKIKC + G+HT CK+G S KPNCG   V + GLTK EK +ILK+HN+FRQK+ARGL
Sbjct  1    NNYCKIKC-RSGIHTLCKFGISTKPNCGKNVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            ETRG PGPQPPAK+M  LVW+DELA IAQVWA QC YGHD CR+ AKY VGQN+A  GST
Sbjct  60   ETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDVCRNTAKYSVGQNIAENGST 119
Query  120  AAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQEN 179
            AA +     +V+MW DEVK+Y  +   ++N ++++GHYTQMVWA TKE+GCGSIKYI+  
Sbjct  120  AASFASVSNMVQMWADEVKNY--QYGSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIENG 177
Query  180  WHKHYLVCNYGPSGNFQNEELYQTK 204
            WH+HYLVCNYGP+GN  NE +Y+ K
Sbjct  178  WHRHYLVCNYGPAGNIGNEPIYERK 202

Sequence Alignment: 14. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 253.3 bits 976,  Expect = 4e-69
 Identities = 135/201 67%, Positives = 161/201 80%, Gaps = 4/201 1%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NNYCKIKC + G+HT CKYG S KPNCG   V + GLTK EK +ILK+HN+FRQK+ARGL
Sbjct  1    NNYCKIKC-RSGIHTLCKYGTSTKPNCGRSVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            ETRGNPGPQPPAK+M  LVW+DELA IAQVWA+QC+YGHD CR+ AKY VGQN+A   +T
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYGHDNCRNTAKYLVGQNIAEQSTT 119
Query  120  AAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQEN 179
            AA +     +VKMW DEVKDY  +   S+N +  +GHYTQMVWA TKE+GCG+IKYI+  
Sbjct  120  AASFEPVSNMVKMWSDEVKDY--QYGSSKNKLNDVGHYTQMVWAKTKEIGCGNIKYIENG 177
Query  180  WHKHYLVCNYGPSGNFQNEELYQTK 204
            WH HYLVCNYGP+GN  NE +Y+ K
Sbjct  178  WHHHYLVCNYGPAGNIGNEPIYEKK 202

Sequence Alignment: 15. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 253.1 bits 975,  Expect = 4e-69
 Identities = 136/198 68%, Positives = 163/198 82%, Gaps = 10/198 5%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NNYCKIKC + G+HT CKYG S KPNCG   V + GLTKQE  +ILK+HN+FRQK+ARGL
Sbjct  1    NNYCKIKC-RSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            ETRGNPGPQPPAK+M  LVW+DELA IAQVWANQC YGHD CR+ AKY VGQN+A   ++
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTS 119
Query  120  AAVYNDPVKLVKMWEDEVKDY---NPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYI 176
            A  + +   +VKMWEDEVKDY   +PK K++     K+GHYTQMVWA TKE+GCGS  YI
Sbjct  120  ADNFVNVSNMVKMWEDEVKDYQYGSPKNKLN-----KVGHYTQMVWAKTKEIGCGSEDYI 174
Query  177  QENWHKHYLVCNYGPSGNFQNEELYQTK 204
            ++ WH+HYLVCNYGP+GN  NE +Y+ K
Sbjct  175  EDGWHRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 16. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 230.6 bits 886,  Expect = 3e-62
 Identities = 124/202 61%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIAR 57
            N+YCKIKC   GVHT C+YG S KP  NC  K + S G T++EK+ I++EHN FRQK+A+
Sbjct  1    NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAK 59
Query  58   GLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALT 116
            GLETRGNPGPQP A NM NLVW+DELA IAQVWA+QCQ   HD CR+  KYQVGQN+A  
Sbjct  60   GLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
Query  117  GSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYI 176
            GS+   +    KL+++WE+EVKD+N     +  NF K+GHYTQMVW NTKEVGCGS+KY+
Sbjct  120  GSSNH-FPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
Query  177  QENWHKHYLVCNYGPSGNFQNEELYQTK 204
            ++N + HYL+CNYGP+GN+  + +Y  K
Sbjct  179  EKNMQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 17. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 230.4 bits 885,  Expect = 3e-62
 Identities = 126/202 62%, Positives = 157/202 77%, Gaps = 7/202 3%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKP---NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIA 56
            N YC IKC K   HT C+YG S KP   NC    + S G+T++EK+ I+ EHN FRQK+A
Sbjct  1    NKYCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVA 59
Query  57   RGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVAL 115
            +GLETRGNPGPQP A +M NLVW+DELAYIAQVWANQCQ+  HD CR+ A+YQVGQN+A 
Sbjct  60   QGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAY 119
Query  116  TGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKY 175
            + STAA Y   V L+ +WE+EVKD+N  +  ++ NF K+GHYTQ+VWA TKEVGCGSIKY
Sbjct  120  SASTAA-YPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKY 178
Query  176  IQENWHKHYLVCNYGPSGNFQNEELYQTK 204
            I++    HYLVCNYGP+GN+  + +Y  K
Sbjct  179  IEKGMKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 18. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 228.9 bits 879,  Expect = 9e-62
 Identities = 122/200 61%, Positives = 157/200 78%, Gaps = 7/200 3%
Query  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARG 58
            +YCKIKC   G+HT C+YG S KP  NC +K + S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
Query  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 117
            LETRGNPGPQP A +M NLVW+DELA+IAQVWA+QCQ   HD CR+ AKYQVGQN+A  G
Sbjct  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
Query  118  STAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
             +     D V L+K+WE+EVKD+N  K  ++ NF K+GHYTQM+WA TKE+GCGS+KY++
Sbjct  121  GSK--LPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMK 178
Query  178  ENWHKHYLVCNYGPSGNFQNEELYQTK 204
             N + HYL+CNYGP+GN+  +  Y  K
Sbjct  179  NNMQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 19. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 228.1 bits 876,  Expect = 1e-61
 Identities = 123/202 60%, Positives = 155/202 76%, Gaps = 6/202 2%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIAR 57
            N+YCKIKC   GVHT C+YG S KP  NC  K + S G T++EK+ I++EHN FRQK+A+
Sbjct  1    NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQ 59
Query  58   GLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALT 116
            GLETRGNPGPQP A NM NLVW+DE A IAQVWA+QCQ   HD CR+  KYQVGQN+A  
Sbjct  60   GLETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
Query  117  GSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYI 176
            GS+   +    KL+++WE+EVKD+N     +  NF K+GHYTQMVW NTKEVGCGS+KY+
Sbjct  120  GSSNH-FPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
Query  177  QENWHKHYLVCNYGPSGNFQNEELYQTK 204
            ++N   HYL+CNYGP+GN+  + +Y  K
Sbjct  179  EKNMKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 20. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 227.6 bits 874,  Expect = 2e-61
 Identities = 124/202 61%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKPN--CGNKKVVSYGLTKQEKQDILKEHNDFRQKIAR 57
            N YC IKC K   HT C+YG S KP+  C    + S G+T++EK+ I+ EHN FRQK+A+
Sbjct  1    NKYCNIKCSKVA-HTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ 59
Query  58   GLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALT 116
            GLETRGNPGPQP A +M NLVW+DELAYIAQVWA+QCQ+  HD CR+ A+YQVGQN+A +
Sbjct  60   GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYS 119
Query  117  GSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYI 176
             STAA Y   V L+ +WE+EVKD+N  +  ++ NF K+GHYTQ+VWA TKEVGCGSIKYI
Sbjct  120  ASTAA-YPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYI 178
Query  177  QENWHKHYLVCNYGPSGNFQNEELYQTK 204
            ++    HYLVCNYGP+GN+  + +Y  K
Sbjct  179  EKGMKSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 21. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 226.1 bits 868,  Expect = 6e-61
 Identities = 125/202 61%, Positives = 156/202 77%, Gaps = 7/202 3%
Query  1    NNYCKIKCLKGGVHTACKYG-SLKP---NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIA 56
            N YC IKC K   HT C+ G S KP   NC    + S G+T++EK+ I+ EHN FRQK+A
Sbjct  1    NKYCNIKCSKVA-HTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVA 59
Query  57   RGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVAL 115
            +GLETRGNPGPQP A +M NLVW+DELAYIAQVWA+QCQ+  HD CR+ A+YQVGQN+A 
Sbjct  60   QGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAY 119
Query  116  TGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKY 175
            + STAA Y   VKL+ +WE+EVKD+N     ++ NF K+GHYTQ+VWA TKEVGCGSIKY
Sbjct  120  SASTAA-YPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKY 178
Query  176  IQENWHKHYLVCNYGPSGNFQNEELYQTK 204
            I++    HYLVCNYGP+GN    ++Y+ K
Sbjct  179  IEKGMKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 22. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 224.1 bits 860,  Expect = 2e-60
 Identities = 120/200 60%, Positives = 154/200 77%, Gaps = 7/200 3%
Query  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARG 58
            +YCKIKC   G+HT C+YG S KP  NC  K + S G T++EK+ I+ EHN FRQK+A+G
Sbjct  6    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
Query  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 117
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
Query  118  STAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
             +     D V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KY++
Sbjct  125  GSN--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 182
Query  178  ENWHKHYLVCNYGPSGNFQNEELYQTK 204
             N + HYL+CNYGP+GN+  +  Y  K
Sbjct  183  NNMQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 23. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 223.1 bits 856,  Expect = 5e-60
 Identities = 120/200 60%, Positives = 153/200 76%, Gaps = 7/200 3%
Query  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARG 58
            +YCKIKC   G+HT C+YG S KP  NC  K + S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
Query  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 117
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
Query  118  STAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
             +     D V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KYI+
Sbjct  121  GSK--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIE 178
Query  178  ENWHKHYLVCNYGPSGNFQNEELYQTK 204
               + HYL+CNYGP+GN+  +  Y  K
Sbjct  179  NKMQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 24. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 220.5 bits 846,  Expect = 3e-59
 Identities = 119/199 59%, Positives = 154/199 77%, Gaps = 8/199 4%
Query  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARG 58
            +YCKI+C   G+HT C+YG S KP  NC  K + S G T++EK+ I+ EHN FRQK+A+G
Sbjct  23   DYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
Query  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 117
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
Query  118  STAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
             +     D V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KY++
Sbjct  142  GSK--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 199
Query  178  ENWHKHYLVCNYGPSGNFQNEELYQTK 204
               + HYL+CNYGP+GN+  + L  TK
Sbjct  200  NKMQNHYLICNYGPAGNYLGQ-LPNTK 225

Sequence Alignment: 25. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 181.0 bits 689,  Expect = 2e-47
 Identities = 102/190 53%, Positives = 130/190 68%, Gaps = 8/190 4%
Query  11   GGVHTACKYGSLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQ 68
            G VHT C+Y S +P  NCG     +  +T  +K+ ILK HND RQK+  G ETRGNPGPQ
Sbjct  4    GAVHTMCQYTSPQPSPNCGTYS--NAHITAADKETILKVHNDERQKVKAGQETRGNPGPQ 61
Query  69   PPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTAAVYNDPVK 128
            P A NM +L W +ELA IAQ W NQC+ GHD CR+V +YQVGQN+A++GSTA    +   
Sbjct  62   PAASNMPDLTWDNELAAIAQRWVNQCKIGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  129  LVKMWEDEVKDYNPKKKFSE----NNFLKIGHYTQMVWANTKEVGCGSIKYIQENWHKHY 184
            LV+MW +EV   N     S     N F+KIGHYTQ+VW  T +VGCG I+++   ++K Y
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  185  LVCNYGPSGNFQNEELYQ 202
            L CNYGP+GN     +YQ
Sbjct  182  LACNYGPAGNMFGAPIYQ 199

Sequence Alignment: 26. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 180.7 bits 688,  Expect = 3e-47
 Identities = 96/203 47%, Positives = 136/203 66%, Gaps = 6/203 2%
Query  2    NYCKIKCLK--GGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NYC ++  K    +HT C+Y S  P     +  + G+T  EK  I+ +HN++RQ++A G 
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGK 61
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            E RG  GPQPPA  M NL W  ELA IAQ WANQC + HD CR+V ++ VGQN+A T S+
Sbjct  62   EMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSS 121
Query  120  AAVYNDPVKLVKMWEDEVKDYNPK--KKF-SENNFL-KIGHYTQMVWANTKEVGCGSIKY 175
                +    ++ +W +EVKD++ +    F S+ N L  +GHYTQ+VWA TK++GCG I +
Sbjct  122  GKNKSTLSDMILLWYNEVKDFDNRWISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRIMF 181
Query  176  IQENWHKHYLVCNYGPSGNFQNEELYQTK 204
             ++NW+KHYLVCNYGP+GN    ++Y+ K
Sbjct  182  KEDNWNKHYLVCNYGPAGNVLGAQIYEIK 210

Sequence Alignment: 27. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 180.1 bits 686,  Expect = 5e-47
 Identities = 97/203 47%, Positives = 137/203 67%, Gaps = 7/203 3%
Query  2    NYCKIKCLK--GGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NYC ++  K    +HT C+Y S  P     +  + G+T  EK  I+ +HN++RQ++A G 
Sbjct  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGK 83
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
            E RG  GPQPPA  M NL W  ELA IAQ WANQC + HD CR+V ++ VGQN+A T S+
Sbjct  84   EMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSS 143
Query  120  AAVYNDPVKLVKMWEDEVKDYNPK--KKF-SENNFL-KIGHYTQMVWANTKEVGCGSIKY 175
                + P +++ +W +EVKD++ +    F S++N L K+GHYTQ+VWA T ++GCG I +
Sbjct  144  GKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIMF 203
Query  176  IQ-ENWHKHYLVCNYGPSGNFQNEELYQTK 204
             + +NW KHYLVCNYGP+GN     +Y+ K
Sbjct  204  KEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 104.5 bits 386,  Expect = 2e-24
 Identities = 73/154 47%, Positives = 96/154 62%, Gaps = 20/154 12%
Query  35   GLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQC 94
            GL    K+ IL  HN  RQ +A G ++    G QP A NMK L W D++A  AQ  A  C
Sbjct  30   GLDANMKKMILDLHNKKRQTVANGQQS----G-QPSAANMKELHWDDQIAANAQRSAETC 84
Query  95   QYGHDT--CRDVAKYQ-VGQNVALTGSTAAVYNDPV-KLVKMWEDEVKDYNPK--KKFSE 148
             + H     R  +KY  +G+N+ + GS    Y DP+ + V  W DEVKD  P   K F  
Sbjct  85   VFQHTAKNLRKTSKYSYLGENIYM-GS----YPDPIPRSVNAWYDEVKDVTPAVVKSFRS 139
Query  149  NNFLKIGHYTQMVWANTKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELYQ 202
               + IGHYTQMVWANT+ +GCG +    +N    Y+ C YGPSGN+  E +Y+
Sbjct  140  GGPM-IGHYTQMVWANTEALGCGLVTASDKN---TYIFCQYGPSGNYPGEPIYK 189

Sequence Alignment: 29. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 82.4 bits 299,  Expect = 1e-17
 Identities = 71/199 35%, Positives = 105/199 52%, Gaps = 16/199 8%
Query  1    NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            ++YC + C  G  +  C    +  +C N K+V+  +T++ K+  L  HN  R+ +A G  
Sbjct  32   DDYCNLNCTNGP-NVGCTKPDVPRDCQNFKLVN--ITERMKKAFLNAHNRKRRLVAAGKG 88
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST- 119
               +    P A  M NL W+  LA +A+    QC+  HD C      + GQN+ + G+T 
Sbjct  89   LLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCEMKHD-CAKTRHGHTGQNLFFYGTTL 147
Query  120  AAVYNDPV-KL-VKMWEDEVKD--YNPKKKFSE--NNFLKIGHYTQMVWANTKEVGCGSI 173
            + + N  + K+ V  W  E KD      KK++    N   IGHYTQ++W NT +VGC   
Sbjct  148  SPIKNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLIWGNTTKVGCAVS 207
Query  174  KYIQE---NWHKHYLV-CNYGPSGNFQNEELYQTK 204
             Y +    N     LV CNY   GN   E +YQ K
Sbjct  208  TYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 30. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 73.9 bits 265,  Expect = 5e-15
 Identities = 65/189 34%, Positives = 101/189 53%, Gaps = 24/189 12%
Query  2    NYCKIKCLKGGVHTACKYGSL-KPNC-GNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            +YC + C     H AC   ++ +  C    K++   L K +   +L  HN  R  +A G 
Sbjct  21   DYCGL-CDN---HDACVMQNVFQSGCPSGAKMID--LNKYQSA-LLDAHNKKRNHVAGGG 73
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQ-VGQNVALTGS 118
            E++     Q     M  + W  ELA +A+    QCQ  HD CR+  K++  GQN+A  G 
Sbjct  74   ESKLKRACQ-----MATMKWDSELAKLAEYNVKQCQMNHDRCRNTVKFKYAGQNLAELGR 128
Query  119  TAAVYNDPVKLVKM----WEDEVKDYNPKKKFS-ENNFL--KIGHYTQMVWANTKEVGCG 171
            +     D  KL++     W +EVKD N     S   N+    IGH+T MV      VGC 
Sbjct  129  SGGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHVGCA 188
Query  172  SIKYIQENWHKHYLV-CNYGPSGNFQNEELYQT 203
            + +Y + N  +++L+ CNY  + N     +Y++
Sbjct  189  ASEYTKSNGFQYFLMACNYATT-NMMEFPIYKS 220

Sequence Alignment: 31. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 71.8 bits 255,  Expect = 7e-15
 Identities = 39/87 44%, Positives = 53/87 60%, Gaps = 2/87 2%
Query  2    NYCKIK-CLKGG-VHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
            NYC ++ C +   +HT C+Y S  P     +  + G+T  EK  I+ +HN++RQ++A G 
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGK 61
Query  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQ 88
            E RG   PQPPA  M NL W  ELA IAQ
Sbjct  62   EMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 32. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 69.4 bits 245,  Expect = 3e-14
 Identities = 32/56 57%, Positives = 44/56 78%, Gaps = 1/56 1%
Query  149  NNFLKIGHYTQMVWANTKEVGCGSIKYIQ-ENWHKHYLVCNYGPSGNFQNEELYQTK 204
            N ++KIGHYTQ+VWA T ++GCG I + + +NW KHYLVCNYGP+GN    ++Y+ K
Sbjct  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69

Sequence Alignment: 33. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 57.7 bits 200,  Expect = 2e-10
 Identities = 59/124 47%, Positives = 81/124 65%, Gaps = 33/124 26%
Query  60   ETRGNPGPQPP----AKN-------MKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQ 108
            ET G PG  P     A N       MK L W DELA +AQ WA   +     C  V   +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---EARTADCSLVHSDR 81
Query  109  VGQNVA---LTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKI-GHYTQMVWAN 164
             G+N+A   + GS A         V++W DE  DY+    ++EN  +K+ GHYTQ+VWAN
Sbjct  82   CGENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWAN 128
Query  165  TKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201
            ++ VGCG  + +  N   + +VCNY P GN   ++ Y
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 34. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 57.7 bits 200,  Expect = 2e-10
 Identities = 58/124 46%, Positives = 81/124 65%, Gaps = 33/124 26%
Query  60   ETRGNPGPQPP----AKN-------MKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQ 108
            ET G PG  P     A N       MK L W DELA +AQ WA   +     C  +   +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDR 81
Query  109  VGQNVA---LTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKI-GHYTQMVWAN 164
             G+N+A   + GS A         V++W DE  DY+    ++EN  +K+ GHYTQ+VWAN
Sbjct  82   CGENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWAN 128
Query  165  TKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201
            ++ VGCG  + +  N   + +VCNY P GN   ++ Y
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 35. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 57.7 bits 200,  Expect = 2e-10
 Identities = 58/124 46%, Positives = 81/124 65%, Gaps = 33/124 26%
Query  60   ETRGNPGPQPP----AKN-------MKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQ 108
            ET G PG  P     A N       MK L W DELA +AQ WA   +     C  +   +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDR 81
Query  109  VGQNVA---LTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKI-GHYTQMVWAN 164
             G+N+A   + GS A         V++W DE  DY+    ++EN  +K+ GHYTQ+VWAN
Sbjct  82   CGENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWAN 128
Query  165  TKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201
            ++ VGCG  + +  N   + +VCNY P GN   ++ Y
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 57.7 bits 200,  Expect = 2e-10
 Identities = 60/124 48%, Positives = 80/124 64%, Gaps = 33/124 26%
Query  60   ETRGNPGPQPP----AKN-------MKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQ 108
            ET G PG  P     A N       MK L W DELA +AQ WA   +     C  V   +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLVHSDR 81
Query  109  VGQNVA---LTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKI-GHYTQMVWAN 164
             G+N+A   + GS A         V++W DE  DY+    ++EN  +K+ GHYTQ+VWAN
Sbjct  82   CGENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWAN 128
Query  165  TKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201
            T+ VGCG  + +  N   +  VCNY P GN   ++ Y
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 57.7 bits 200,  Expect = 2e-10
 Identities = 57/123 46%, Positives = 80/123 65%, Gaps = 33/123 26%
Query  61   TRGNPGPQPP----AKN-------MKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQV 109
            T G PG  P     A N       MK L W DELA +AQ WA   +     C  +   + 
Sbjct  26   TYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDRC 82
Query  110  GQNVA---LTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKI-GHYTQMVWANT 165
            G+N+A   + GS A         V++W DE  DY+    ++EN  +K+ GHYTQ+VWAN+
Sbjct  83   GENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWANS 129
Query  166  KEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201
            + VGCG  + +  N   + +VCNY P GN   ++ Y
Sbjct  130  ERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 57.7 bits 200,  Expect = 2e-10
 Identities = 60/124 48%, Positives = 80/124 64%, Gaps = 33/124 26%
Query  60   ETRGNPGPQPP----AKN-------MKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQ 108
            ET G PG  P     A N       MK L W DELA +AQ WA   +     C  V   +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLVHSDR 81
Query  109  VGQNVA---LTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKI-GHYTQMVWAN 164
             G+N+A   + GS A         V++W DE  DY+    ++EN  +K+ GHYTQ+VWAN
Sbjct  82   CGENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWAN 128
Query  165  TKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201
            T+ VGCG  + +  N   +  VCNY P GN   ++ Y
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 39. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 56.0 bits 194,  Expect = 1e-09
 Identities = 56/188 29%, Positives = 92/188 48%, Gaps = 26/188 13%
Query  2    NYCKIKCLKG-GVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
            +YC + C  G G H  C    +  +CG +K  +  +TK+ K+ IL + ND R  +A+G  
Sbjct  25   DYCSL-CRGGRGEHVGCGSPGFSSDCG-QKARTRKFTKEHKKVILDKINDVRDHVAKG-- 80
Query  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQV-GQ-NVALTG- 117
            + G     P A  MK +VW +ELA +A+     C      CR   ++   GQ N  +   
Sbjct  81   SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFYAD 136
Query  118  ---STAAVYNDPVKLVKMWE-----DEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVG 169
               ST ++ +  +K     +     D ++ Y P         L +   +  V A    VG
Sbjct  137  KMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALA-ISDRVTA----VG 191
Query  170  CGSIKYIQENWHKHYLVCNYGPSGNFQNEELYQT 203
            CG   +      +  L CN+    ++ N  +Y+T
Sbjct  192  CGLTTWKLGGKARALLTCNFSSENDY-NRPVYKT 224

Sequence Alignment: 40. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 55.2 bits 190,  Expect = 1e-09
 Identities = 52/141 36%, Positives = 80/141 56%, Gaps = 27/141 19%
Query  35   GLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQC 94
            GL  +  QDIL EHN FR K              PP      L W+  LA  +Q +A + 
Sbjct  12   GLNDKAIQDILNEHNMFRAK-----------EHVPP------LTWNTTLAKFSQDYA-ES 53
Query  95   QYGHDTCRDV-AKYQVGQNVALTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLK 153
            +   D C+ V +    G+N+ + GS A  +   V     W DE K Y+      +   + 
Sbjct  54   KLKKD-CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQGKM- 107
Query  154  IGHYTQMVWANTKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201
             GHYT +VW +T  VGCG +  + ++     ++C+Y P GN++N++ Y
Sbjct  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153

Sequence Alignment: 41. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 40.9 bits 131,  Expect = 6e-06
 Identities = 20/33 60%, Positives = 25/33 75%, Gaps = 4/33 12%
Query  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYG 35
            +YCKIKC   G+HT C+YG S KP  NC +K + S G
Sbjct  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 42. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 41.0 bits 134,  Expect = 2e-05
 Identities = 49/142 34%, Positives = 81/142 57%, Gaps = 29/142 20%
Query  31   VVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVW 90
            +VS  ++K+E    ++EHN  R+++       GN          K L W+  LA  AQ +
Sbjct  20   LVSANISKEEIDGFVEEHNKARKEV-------GN----------KPLKWNTTLAQYAQEY 62
Query  91   ANQCQYGHDTCRDVAKYQVGQNVALTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENN 150
            A++ + G D   + +  + G+N+A +G   +         K W  E + Y+ K      +
Sbjct  63   ADK-RVG-DCAMEHSMGRWGENLA-SGDGMS----GAAATKYWVTEKEFYDEKSNKCVKD 115
Query  151  FLKIGHYTQMVWANTKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201
              + GHY  +VW  T EVGCG  K    N  ++Y+VC+Y P    ++E  Y
Sbjct  116  --ECGHYLAVVWGKTTEVGCGISKC---NNGQNYVVCSYDPMYQPEDERPY 161

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.