The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

PFYPIPSALPFPLPIHSLFSRRTRLFRFSRTAARAGTEHTLPPLPYEYNALEPFISADIM
MVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAP
QSQGGGQLNDGPLKQAIDKEFGDFEKFKAAFTAKALGIQGSGWCWLGLSKTGSLDLVVAK
DQDTLTTHHPIIGWDGWEHAWYLQYKNDKASYLKQWWNVVNWSEAESRYSEGLKASL
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD68071 Mala s 11 237 1647 382.2 8.4e-108
Q92450 Asp f 6 210 792 187.3 3.3e-49
AAB60779 Asp f 6 221 792 187.3 3.6e-49
CAB53458 Hev b 10.0102 205 658 156.8 5e-40
AAA16792 Hev b 10.0101 233 656 156.3 8.2e-40
CAC13961 Hev b 10.0103 205 649 154.7 2.1e-39
EF470980 Pis v 4.0101 230 647 154.2 3.3e-39
P86254 Alt a 14.0101 25 115 36.9 7.5e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mala s 11 Sequence ID: CAD68071

 Score = 382.2 bits 1647,  Expect = 8e-108
 Identities = 237/237 100%, Positives = 237/237 100%, Gaps = 0/237 0%
Query  1    PFYPIPSALPFPLPIHSLFSRRTRLFRFSRTAARAGTEHTLPPLPYEYNALEPFISADIM 60
            PFYPIPSALPFPLPIHSLFSRRTRLFRFSRTAARAGTEHTLPPLPYEYNALEPFISADIM
Sbjct  1    PFYPIPSALPFPLPIHSLFSRRTRLFRFSRTAARAGTEHTLPPLPYEYNALEPFISADIM 60
Query  61   MVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAP 120
            MVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAP
Sbjct  61   MVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAP 120
Query  121  QSQGGGQLNDGPLKQAIDKEFGDFEKFKAAFTAKALGIQGSGWCWLGLSKTGSLDLVVAK 180
            QSQGGGQLNDGPLKQAIDKEFGDFEKFKAAFTAKALGIQGSGWCWLGLSKTGSLDLVVAK
Sbjct  121  QSQGGGQLNDGPLKQAIDKEFGDFEKFKAAFTAKALGIQGSGWCWLGLSKTGSLDLVVAK 180
Query  181  DQDTLTTHHPIIGWDGWEHAWYLQYKNDKASYLKQWWNVVNWSEAESRYSEGLKASL 237
            DQDTLTTHHPIIGWDGWEHAWYLQYKNDKASYLKQWWNVVNWSEAESRYSEGLKASL
Sbjct  181  DQDTLTTHHPIIGWDGWEHAWYLQYKNDKASYLKQWWNVVNWSEAESRYSEGLKASL 237

Sequence Alignment: 2. Allergen Name: Asp f 6 Sequence ID: Q92450

 Score = 187.3 bits 792,  Expect = 3e-49
 Identities = 112/197 56%, Positives = 142/197 72%, Gaps = 2/197 1%
Query  38   EHTLPPLPYEYNALEPFISADIMMVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMEL 97
            ++TLPPLPY Y+AL+P+IS  IM +HH KHHQTYVN LNA+ +A   A +A DV K + +
Sbjct  4    QYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVSV 63
Query  98   LTAVKFNGGGHVNHALFWKTMAPQSQGGGQLNDGP-LKQAIDKEFGDFEKFKAAFTAKAL 156
              A+KFNGGGH+NH+LFWK +AP+  GGG+++  P LK AI++ +G F+KFK AF    L
Sbjct  64   QQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTLL 123
Query  157  GIQGSGWCWLGLS-KTGSLDLVVAKDQDTLTTHHPIIGWDGWEHAWYLQYKNDKASYLKQ 215
            GIQGSGW WL      G LD+    DQD +T   P+ G D WEHA+YLQY NDKASY K 
Sbjct  124  GIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAYYLQYLNDKASYAKG 183
Query  216  WWNVVNWSEAESRYSEGLK 234
             WNV+NW+EAE+RY  G K
Sbjct  184  IWNVINWAEAENRYIAGDK 202

Sequence Alignment: 3. Allergen Name: Asp f 6 Sequence ID: AAB60779

 Score = 187.3 bits 792,  Expect = 4e-49
 Identities = 112/197 56%, Positives = 142/197 72%, Gaps = 2/197 1%
Query  38   EHTLPPLPYEYNALEPFISADIMMVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMEL 97
            ++TLPPLPY Y+AL+P+IS  IM +HH KHHQTYVN LNA+ +A   A +A DV K + +
Sbjct  15   QYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVSV 74
Query  98   LTAVKFNGGGHVNHALFWKTMAPQSQGGGQLNDGP-LKQAIDKEFGDFEKFKAAFTAKAL 156
              A+KFNGGGH+NH+LFWK +AP+  GGG+++  P LK AI++ +G F+KFK AF    L
Sbjct  75   QQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTLL 134
Query  157  GIQGSGWCWLGLS-KTGSLDLVVAKDQDTLTTHHPIIGWDGWEHAWYLQYKNDKASYLKQ 215
            GIQGSGW WL      G LD+    DQD +T   P+ G D WEHA+YLQY NDKASY K 
Sbjct  135  GIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAYYLQYLNDKASYAKG 194
Query  216  WWNVVNWSEAESRYSEGLK 234
             WNV+NW+EAE+RY  G K
Sbjct  195  IWNVINWAEAENRYIAGDK 213

Sequence Alignment: 4. Allergen Name: Hev b 10.0102 Sequence ID: CAB53458

 Score = 156.8 bits 658,  Expect = 5e-40
 Identities = 95/192 49%, Positives = 128/192 66%, Gaps = 5/192 2%
Query  40   TLPPLPYEYNALEPFISADIMMVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMELLT 99
            +LP LPY+Y ALEP IS +IM +HH KHHQTY+ N N + +  NDA++  D    ++L +
Sbjct  4    SLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVKLQS 63
Query  100  AVKFNGGGHVNHALFWKTMAPQSQGGGQLNDGPLKQAIDKEFGDFEKFKAAFTAKALGIQ 159
            A+KFNGGGHVNH++FWK +AP  +GGG+L  G L  AID +FG +EK+     A+ + +Q
Sbjct  64   AIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGVALQ 123
Query  160  GSGWCWLGLSKT-GSLDLVVAKDQDTLTTHHP----IIGWDGWEHAWYLQYKNDKASYLK 214
            GSGW WL L K    L +    +QD L T  P    ++G D WEHA+YLQYKN +  YLK
Sbjct  124  GSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLK 183
Query  215  QWWNVVNWSEAESRYSE 231
              W V+NW  A   Y++
Sbjct  184  NIWKVMNWKYASEVYAK 200

Sequence Alignment: 5. Allergen Name: Hev b 10.0101 Sequence ID: AAA16792

 Score = 156.3 bits 656,  Expect = 8e-40
 Identities = 100/219 45%, Positives = 136/219 62%, Gaps = 9/219 4%
Query  13   LPIHSLFSRRTRLFRFSRTAA----RAGTEHTLPPLPYEYNALEPFISADIMMVHHGKHH 68
            + + SL +R+     F         R     +LP LPY+Y ALEP IS +IM +HH KHH
Sbjct  1    MALRSLVTRKNLPSAFKAATGLGQLRGLQTFSLPDLPYDYGALEPAISGEIMQLHHQKHH 60
Query  69   QTYVNNLNASTKAYNDAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAPQSQGGGQL 128
            QTY+ N N + +  NDA++  D    ++L +A+KFNGGGHVNH++FWK +AP  +GGG+L
Sbjct  61   QTYITNYNKALEQLNDAIEKGDSAAVVKLQSAIKFNGGGHVNHSIFWKNLAPVREGGGEL 120
Query  129  NDGPLKQAIDKEFGDFEKFKAAFTAKALGIQGSGWCWLGLSKT-GSLDLVVAKDQDTLTT 187
              G L  AID +FG +EK+     A+   +QGSGW WL L K    L +    +QD L T
Sbjct  121  PHGSLGWAIDADFGSLEKLIQLMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVT 180
Query  188  HHP----IIGWDGWEHAWYLQYKNDKASYLKQWWNVVNWSEAESRYSE 231
              P    ++G D WEHA+YLQYKN +  YLK  W V+NW  A   Y++
Sbjct  181  KGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYASEVYAK 228

Sequence Alignment: 6. Allergen Name: Hev b 10.0103 Sequence ID: CAC13961

 Score = 154.7 bits 649,  Expect = 2e-39
 Identities = 94/192 48%, Positives = 127/192 66%, Gaps = 5/192 2%
Query  40   TLPPLPYEYNALEPFISADIMMVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMELLT 99
            +LP LPY+Y ALEP IS +IM +HH KHHQTY+ N N + +  NDA++  D    ++L +
Sbjct  4    SLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVKLQS 63
Query  100  AVKFNGGGHVNHALFWKTMAPQSQGGGQLNDGPLKQAIDKEFGDFEKFKAAFTAKALGIQ 159
            A+KFNGGGHVNH++FWK +AP  +GGG+L  G L  AID +FG +EK+     A+   ++
Sbjct  64   AIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGAALR 123
Query  160  GSGWCWLGLSKT-GSLDLVVAKDQDTLTTHHP----IIGWDGWEHAWYLQYKNDKASYLK 214
            GSGW WL L K    L +    +QD L T  P    ++G D WEHA+YLQYKN +  YLK
Sbjct  124  GSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLK 183
Query  215  QWWNVVNWSEAESRYSE 231
              W V+NW  A   Y++
Sbjct  184  NIWKVMNWKYASEVYAK 200

Sequence Alignment: 7. Allergen Name: Pis v 4.0101 Sequence ID: EF470980

 Score = 154.2 bits 647,  Expect = 3e-39
 Identities = 101/218 46%, Positives = 137/218 62%, Gaps = 10/218 4%
Query  13   LPIHSLFSRRT--RLFRFS-RTAARAGTEHTLPPLPYEYNALEPFISADIMMVHHGKHHQ 69
            + + S  +R+T    +R+  ++  R     TLP LPYEY ALEP IS++IM +HH KHHQ
Sbjct  1    MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQ 60
Query  70   TYVNNLNASTKAYNDAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAPQSQGGGQLN 129
            TY+ N N + +  + A+   D    ++L +A+KFNGGGH+NH++FWK + P S+GGG+  
Sbjct  61   TYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPP 120
Query  130  DGPLKQAIDKEFGDFEKFKAAFTAKALGIQGSGWCWLGLSKTGSLDLVV--AKDQDTLTT 187
             G L  AID  FG  E +     A+   +QGSGW WLGL K  S  LVV    +QD L T
Sbjct  121  HGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKE-SKKLVVETTANQDPLVT 179
Query  188  HHP----IIGWDGWEHAWYLQYKNDKASYLKQWWNVVNWSEAESRYSE 231
              P    ++G D WEHA+YLQYKN +  YLK  W V+NW  A   Y +
Sbjct  180  KGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQK 227

Sequence Alignment: 8. Allergen Name: Alt a 14.0101 Sequence ID: P86254

 Score = 36.9 bits 115,  Expect = 8e-05
 Identities = 13/20 65%, Positives = 17/20 85%, Gaps = 0/20 0%
Query  103  FNGGGHVNHALFWKTMAPQS 122
            FN GGH+NH+LFW+ +AP S
Sbjct  1    FNAGGHINHSLFWQNLAPAS 20

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.