The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQATYHYYNPAQNNWDLRAVSAYCSTWDA
DKPYSWRYGWTAFCGPAGPRCLRTNAAVTVR
Sequence Info Allergen Name Length Opt Bits Score E Value
P81729 Bra r 2 91 701 181.7 2.8e-48
P02877 Hev b 6.01 204 201 56.7 2.6e-10
CAB01591 Pers a 1 326 176 50.4 3.2e-08
Exo m 1.0101 40 154
Q42428 Cas s 5 316 166 47.9 1.8e-07
P0DKH8 Fag e 4.0102 40 153 44.9 1.9e-07
AAA34256 Tri a 18 212 163 47.2 1.9e-07
AAA34257 Tri a 18 186 158 46.0 4e-07
AAA34258 Tri a 18 213 157 45.7 5.5e-07
Q8VXF1 Mus a 2.0101 318 155 45.2 1.2e-06
CAD24068 Hev b 11.0102 295 152 44.4 1.8e-06
CAC42881 Hev b 11.0101 295 152 44.4 1.8e-06
P29022 Zea m 8.0101 280 127 38.2 0.00013
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bra r 2 Sequence ID: P81729

 Score = 181.7 bits 701,  Expect = 3e-48
 Identities = 91/91 100%, Positives = 91/91 100%, Gaps = 0/91 0%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQATYHYYNPAQNNWDLRAVSAYCSTWDA 60
            QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQATYHYYNPAQNNWDLRAVSAYCSTWDA
Sbjct  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQATYHYYNPAQNNWDLRAVSAYCSTWDA 60
Query  61   DKPYSWRYGWTAFCGPAGPRCLRTNAAVTVR 91
            DKPYSWRYGWTAFCGPAGPRCLRTNAAVTVR
Sbjct  61   DKPYSWRYGWTAFCGPAGPRCLRTNAAVTVR 91

Sequence Alignment: 2. Allergen Name: Hev b 6.01 Sequence ID: P02877

 Score = 56.7 bits 201,  Expect = 3e-10
 Identities = 64/91 70%, Positives = 74/91 81%, Gaps = 33/91 36%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQ-------------------ATYHYYNP 41
            QAGG+ C  N+CCSQ+G+CG+T +YCSPD+NCQ                   ATYH YN 
Sbjct  23   QAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGGSASNVLATYHLYNS 82
Query  42   AQNNWDLRAVSAYCSTWDADKPYSWR--YGWTAFCGPAGP-------RCLR-----TNAA 87
              + WDL A SAYCSTWDA+KPYSWR  YGWTAFCGP G        +CL      T A 
Sbjct  83   QDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAK 142
Query  88   VTVR 91
             TVR
Sbjct  143  TTVR 146

Sequence Alignment: 3. Allergen Name: Pers a 1 Sequence ID: CAB01591

 Score = 50.4 bits 176,  Expect = 3e-08
 Identities = 21/40 52%, Positives = 28/40 70%, Gaps = 2/40 5%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQATYHYYNPA 42
            QAGG  C G +CCSQ+G+CG+T+DYC P   CQ+      P+
Sbjct  31   QAGGALCPGGLCCSQFGWCGSTSDYCGP--TCQSQCGGVTPS 70

Sequence Alignment: 4. Allergen Name: Exo Sequence ID:

 Score = 45.1 bits 154,  Expect = 2e-07
 Identities = 18/33 54%, Positives = 24/33 72%, Gaps = 2/33 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSP--DNNCQ 33
            Q GG TC G +CCSQ+G+CG+T  YC     +NC+
Sbjct  6    QGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK 40

Sequence Alignment: 5. Allergen Name: Cas s 5 Sequence ID: Q42428

 Score = 47.9 bits 166,  Expect = 2e-07
 Identities = 20/32 62%, Positives = 25/32 78%, Gaps = 2/32 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34
            QAGG  CA N+CCSQ+G+CG TA+YC     CQ+
Sbjct  24   QAGGAACANNLCCSQFGWCGNTAEYCG--AGCQS 55

Sequence Alignment: 6. Allergen Name: Fag e 4.0102 Sequence ID: P0DKH8

 Score = 44.9 bits 153,  Expect = 2e-07
 Identities = 18/33 54%, Positives = 24/33 72%, Gaps = 2/33 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSP--DNNCQ 33
            Q GG TC G +CCSQ+G+CG+T  YC     +NC+
Sbjct  6    QGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR 40

Sequence Alignment: 7. Allergen Name: Tri a 18 Sequence ID: AAA34256

 Score = 47.2 bits 163,  Expect = 2e-07
 Identities = 26/56 46%, Positives = 30/56 53%, Gaps = 5/56 8%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNN---CQATYHYYNPAQNNWDLRAVSAYCST 57
            QAGG TC  N CCSQYGYCG  A+YC        C+A       +Q    L   +  CS 
Sbjct  75   QAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIK--CGSQAGGKLCPNNLCCSQ 132
Query  58   W 58
            W
Sbjct  133  W 133
 Score = 42.0 bits 142,  Expect = 7e-06
 Identities = 17/31 54%, Positives = 18/31 58%, Gaps = 2/31 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQ 33
            Q     C  N+CCSQYGYCG   DYC     CQ
Sbjct  32   QGSNMECPNNLCCSQYGYCGMGGDYCG--KGCQ 62
 Score = 37.7 bits 125,  Expect = 0.0001
 Identities = 15/31 48%, Positives = 19/31 61%, Gaps = 2/31 6%
Query  2    AGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34
            AGG+ C  N CCS++G CG    YC     CQ+
Sbjct  162  AGGRVCTNNYCCSKWGSCGIGPGYCG--AGCQS 192

Sequence Alignment: 8. Allergen Name: Tri a 18 Sequence ID: AAA34257

 Score = 46.0 bits 158,  Expect = 4e-07
 Identities = 25/56 44%, Positives = 31/56 55%, Gaps = 5/56 8%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNN---CQATYHYYNPAQNNWDLRAVSAYCST 57
            QAGG+TC  N CCSQYG+CG  A+YC        C+A       +Q    L   +  CS 
Sbjct  49   QAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIK--CGSQAGGKLCPNNLCCSQ 106
Query  58   W 58
            W
Sbjct  107  W 107
 Score = 44.0 bits 150,  Expect = 2e-06
 Identities = 18/31 58%, Positives = 19/31 61%, Gaps = 2/31 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQ 33
            Q  G  C  N+CCSQYGYCG   DYC     CQ
Sbjct  6    QGSGMECPNNLCCSQYGYCGMGGDYCG--KGCQ 36
 Score = 37.7 bits 125,  Expect = 0.0001
 Identities = 15/31 48%, Positives = 19/31 61%, Gaps = 2/31 6%
Query  2    AGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34
            AGG+ C  N CCS++G CG    YC     CQ+
Sbjct  136  AGGRVCTNNYCCSKWGSCGIGPGYCG--AGCQS 166

Sequence Alignment: 9. Allergen Name: Tri a 18 Sequence ID: AAA34258

 Score = 45.7 bits 157,  Expect = 5e-07
 Identities = 25/56 44%, Positives = 31/56 55%, Gaps = 5/56 8%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNN---CQATYHYYNPAQNNWDLRAVSAYCST 57
            QAGG TC  N CCSQYG+CG  A+YC        C+A       +Q+   L   +  CS 
Sbjct  76   QAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIK--CGSQSGGKLCPNNLCCSQ 133
Query  58   W 58
            W
Sbjct  134  W 134
 Score = 42.0 bits 142,  Expect = 7e-06
 Identities = 17/31 54%, Positives = 18/31 58%, Gaps = 2/31 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQ 33
            Q     C  N+CCSQYGYCG   DYC     CQ
Sbjct  33   QGSNMECPNNLCCSQYGYCGMGGDYCG--KGCQ 63
 Score = 37.7 bits 125,  Expect = 0.0001
 Identities = 15/31 48%, Positives = 19/31 61%, Gaps = 2/31 6%
Query  2    AGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34
            AGG+ C  N CCS++G CG    YC     CQ+
Sbjct  163  AGGRVCTNNYCCSKWGSCGIGPGYCG--AGCQS 193

Sequence Alignment: 10. Allergen Name: Mus a 2.0101 Sequence ID: Q8VXF1

 Score = 45.2 bits 155,  Expect = 1e-06
 Identities = 19/32 59%, Positives = 22/32 68%, Gaps = 2/32 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34
            QAGG  C G +CCSQYG+CG T  YC     CQ+
Sbjct  25   QAGGALCPGGLCCSQYGWCGNTDPYCG--QGCQS 56

Sequence Alignment: 11. Allergen Name: Hev b 11.0102 Sequence ID: CAD24068

 Score = 44.4 bits 152,  Expect = 2e-06
 Identities = 18/32 56%, Positives = 23/32 71%, Gaps = 2/32 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34
            QAGG  C G +CCSQYG+C  T +YC   + CQ+
Sbjct  6    QAGGALCPGGLCCSQYGWCANTPEYCG--SGCQS 37

Sequence Alignment: 12. Allergen Name: Hev b 11.0101 Sequence ID: CAC42881

 Score = 44.4 bits 152,  Expect = 2e-06
 Identities = 18/32 56%, Positives = 23/32 71%, Gaps = 2/32 6%
Query  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34
            QAGG  C G +CCSQYG+C  T +YC   + CQ+
Sbjct  6    QAGGALCPGGLCCSQYGWCANTPEYCG--SGCQS 37

Sequence Alignment: 13. Allergen Name: Zea m 8.0101 Sequence ID: P29022

 Score = 38.2 bits 127,  Expect = 0.0001
 Identities = 15/26 57%, Positives = 19/26 73%, Gaps = 2/26 7%
Query  7    CAGNICCSQYGYCGTTADYCSPDNNCQA 34
            C  N CCS++GYCGTT  YC   + CQ+
Sbjct  30   CQPNFCCSKFGYCGTTDAYCG--DGCQS 55

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.