The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY
SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAH
KARLERPQIRVPPPAPEKA
Sequence Info Allergen Name Length Opt Bits Score E Value
P43217 Par j 1 139 989 213.3 2e-57
CAI94601 Par j 1.0103 139 985 212.4 3.5e-57
O04404 Par j 1 176 960 207.2 1.7e-55
CAA54587 Par j 1.0101 133 945 204.1 1.1e-54
Q40905 Par j 1 138 656 144.2 1.2e-36
O04403 Par j 2 133 352 81.1 1.1e-17
P55958 Par j 2 133 346 79.9 2.7e-17
A0A059SSZ0 Pun g 1.0201 120 242 58.3 7.5e-11
A0A059STC4 Pun g 1.0101 120 239 57.7 1.2e-10
NP_001316123 Sola l 7.0101 115 236 57.1 1.7e-10
P82007 Hel a 3.0101 116 230 55.8 4.1e-10
P93224 Sola l 3.0101 114 228 55.4 5.3e-10
AAB42069 Lyc e 3 114 228 55.4 5.3e-10
P19656-1 Zea m 14.0101 120 226 55.0 7.5e-10
O04004 Amb a 6 118 223 54.4 1.1e-09
P19656-2 Zea m 14.0102 128 222 54.2 1.4e-09
QIN55516 Art ca 3.0102 117 219 53.6 2e-09
W0U0V5 Can s 3.0101 91 212 52.2 4.1e-09
ANC85027 Art si 3.0102 116 207 51.1 1.1e-08
ACE07187 Art v 3.0202 116 207 51.1 1.1e-08
ANC85020 Art ar 3.0102 116 207 51.1 1.1e-08
CAL07989 Pla a 3.0101 118 207 51.1 1.1e-08
AAL25839 Hev b 12 116 206 50.9 1.3e-08
P85894 Mor n 3.0101 91 202 50.1 1.7e-08
P81402 Pru p 3 91 201 49.9 2e-08
ABY21307 Pla or 3.0101 118 203 50.2 2e-08
ANC85025 Art la 3.0102 115 202 50.0 2.3e-08
EU564847 Art v 3.0301 117 202 50.0 2.3e-08
ANC85023 Art gm 3.0102 117 201 49.8 2.7e-08
A0AT29 Len c 3.0101 118 201 49.8 2.7e-08
ACV04796 Api g 2 118 200 49.6 3.1e-08
19846220 Tri a 14.0101 90 197 49.0 3.5e-08
CAB96876 Pru p 3 91 197 49.0 3.5e-08
ANC85017 Art an 3.0101 117 199 49.4 3.5e-08
ANC85021 Art ca 3.0101 117 199 49.4 3.5e-08
A0A059ST23 Pun g 1.0301 120 199 49.4 3.7e-08
ABX56711 Ara h 9.0101 116 197 49.0 4.7e-08
ANC85022 Art gm 3.0101 117 196 48.8 5.5e-08
ANC85026 Art si 3.0101 116 195 48.6 6.2e-08
ABU95411 Sin a 3.0101 92 193 48.2 6.4e-08
ANC85018 Art an 3.0102 117 194 48.4 7.3e-08
ABX75045 Ara h 9.0201 92 191 47.8 8.5e-08
A0A161AT60 Pis s 3.0101 120 193 48.2 8.7e-08
CAH69206 Tri tu 14.0101 115 192 48.0 9.5e-08
P81651 Pru ar 3 91 190 47.6 9.7e-08
Q8VX12 Fra a 3.0101 117 191 47.7 1.1e-07
ACN11576 Pru du 3.0101 123 190 47.5 1.4e-07
Q0Z8V0 Rub i 3.0101 117 189 47.3 1.5e-07
EU564845 Art v 3.0201 114 188 47.1 1.7e-07
ANC85024 Art la 3.0101 116 188 47.1 1.7e-07
ANC85019 Art ar 3.0101 116 188 47.1 1.7e-07
ADC80503 Pha v 3.0201 118 185 46.5 2.7e-07
Q9M5X6 Pyr c 3 115 183 46.1 3.5e-07
Q9M5X8 Pru av 3 117 182 45.9 4.1e-07
Q9M5X7 Mal d 3 115 181 45.7 4.6e-07
Q4PLT9 Fra a 3.0102 117 181 45.7 4.7e-07
Q4PLT6 Fra a 3.0202 117 174 44.2 1.3e-06
Q4PLU0 Fra a 3.0201 117 174 44.2 1.3e-06
P82534 Pru d 3 91 171 43.7 1.5e-06
AAA32970 Hor v 1 117 172 43.8 1.7e-06
ADC80502 Pha v 3.0101 115 171 43.6 1.9e-06
CAA42832 Hor v 1 134 169 43.2 3.1e-06
XP_019446786 Lup an 3.0101 116 165 42.4 4.7e-06
A0A510A9S3 Ara h 17.0101 93 163 42.0 4.8e-06
AAK28533 Cor a 8 115 160 41.3 9.5e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 213.3 bits 989,  Expect = 2e-57
 Identities = 139/139 100%, Positives = 139/139 100%, Gaps = 0/139 0%
Query  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
            QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY
Sbjct  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
Query  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAH 120
            SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAH
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAH 120
Query  121  KARLERPQIRVPPPAPEKA 139
            KARLERPQIRVPPPAPEKA
Sbjct  121  KARLERPQIRVPPPAPEKA 139

Sequence Alignment: 2. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 212.4 bits 985,  Expect = 4e-57
 Identities = 138/139 99%, Positives = 139/139 100%, Gaps = 0/139 0%
Query  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
            QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY
Sbjct  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
Query  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAH 120
            SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKT+GVVPRQPQLPVSLRHGPVTGPSDPAH
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAH 120
Query  121  KARLERPQIRVPPPAPEKA 139
            KARLERPQIRVPPPAPEKA
Sbjct  121  KARLERPQIRVPPPAPEKA 139

Sequence Alignment: 3. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 207.2 bits 960,  Expect = 2e-55
 Identities = 135/139 97%, Positives = 138/139 99%, Gaps = 0/139 0%
Query  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
            +ETCGT+VRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTG QRVHACECIQTAMKTY
Sbjct  38   EETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTY 97
Query  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAH 120
            SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKT+GVVPRQPQLPVSLRHGPVTGPSDPAH
Sbjct  98   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAH 157
Query  121  KARLERPQIRVPPPAPEKA 139
            KARLERPQIRVPPPAPEKA
Sbjct  158  KARLERPQIRVPPPAPEKA 176

Sequence Alignment: 4. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 204.1 bits 945,  Expect = 1e-54
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  7    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 66
            MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
Sbjct  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
Query  67   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 126
            LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER
Sbjct  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 120
Query  127  PQIRVPPPAPEKA 139
            PQIRVPPPAPEKA
Sbjct  121  PQIRVPPPAPEKA 133

Sequence Alignment: 5. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 144.2 bits 656,  Expect = 1e-36
 Identities = 92/97 94%, Positives = 96/97 98%, Gaps = 0/97 0%
Query  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
            +ETCGT+V ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY
Sbjct  37   EETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 96
Query  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVV 97
            SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKT+GV+
Sbjct  97   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVL 133

Sequence Alignment: 6. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 81.1 bits 352,  Expect = 1e-17
 Identities = 49/90 54%, Positives = 61/90 67%, Gaps = 1/90 1%
Query  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
            CG +V  +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I
Sbjct  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
Query  64   DGKLVSEVPKHCGIVDSKLPPIDVNMDCKTV 94
              +LV+EVPK CGI  + LPPI  + DC  +
Sbjct  95   KNELVAEVPKKCGIT-TTLPPITADFDCSKI 124

Sequence Alignment: 7. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 79.9 bits 346,  Expect = 3e-17
 Identities = 49/93 52%, Positives = 63/93 67%, Gaps = 1/93 1%
Query  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
            +E CG +V+ +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  
Sbjct  32   EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGI 91
Query  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTV 94
            S I  +LV+EVPK C I  + LPPI  + DC  +
Sbjct  92   SGIKNELVAEVPKKCDI-KTTLPPITADFDCSKI 124

Sequence Alignment: 8. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 58.3 bits 242,  Expect = 8e-11
 Identities = 32/89 35%, Positives = 50/89 56%, Gaps = 4/89 4%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  +L PC+P+ +G    PS  CCSG + L+   KT P R  AC C++   ++ + 
Sbjct  30   TCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITG 89
Query  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
            I+   V  +P  CG+ +  K+ P   + DC  V
Sbjct  90   INYGRVGALPGKCGVSIPYKISP---STDCSRV 119

Sequence Alignment: 9. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 57.7 bits 239,  Expect = 1e-10
 Identities = 33/89 37%, Positives = 51/89 57%, Gaps = 4/89 4%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  +L PC+P+ +         CCSG K LDG  +T P R   C+C+++A  + S 
Sbjct  30   TCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISG 89
Query  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
            I+  LV+ +P  CG+ +  K+ P   + DC  V
Sbjct  90   INYGLVASLPAKCGVNIPYKISP---STDCARV 119

Sequence Alignment: 10. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 57.1 bits 236,  Expect = 2e-10
 Identities = 34/88 38%, Positives = 49/88 55%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFV-QGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
            TCG +   L PC+PF+ QG E  P   CCSG + L+G T++   R  AC C++ A   Y 
Sbjct  26   TCGQVDANLAPCVPFLTQGGE--PGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYP 83
Query  62   DIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTV 94
            ++       +P  CGI  S   PI   ++C T+
Sbjct  84   NLKDDAAQSLPSKCGI--SLTVPISRTVNCDTI 114

Sequence Alignment: 11. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 55.8 bits 230,  Expect = 4e-10
 Identities = 35/88 39%, Positives = 52/88 59%, Gaps = 4/88 4%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   L PCLP+++   K P+  CC+GAK+L G T+T   R  AC+C +TA      
Sbjct  28   TCNDVTGNLTPCLPYLRSGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK- 85
Query  63   IDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTV 94
            +   + S +P  CGI  S   PI+ N++C T+
Sbjct  86   VRPDMASSLPGKCGISTS--IPINPNVNCNTI 115

Sequence Alignment: 12. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 55.4 bits 228,  Expect = 5e-10
 Identities = 34/87 39%, Positives = 50/87 57%, Gaps = 6/87 6%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++A  +   
Sbjct  26   SCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
            ID    + +P  CG+ +  K+ P   + DC TV
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113

Sequence Alignment: 13. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 55.4 bits 228,  Expect = 5e-10
 Identities = 34/87 39%, Positives = 50/87 57%, Gaps = 6/87 6%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++A  +   
Sbjct  26   SCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
            ID    + +P  CG+ +  K+ P   + DC TV
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113

Sequence Alignment: 14. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 55.0 bits 226,  Expect = 8e-10
 Identities = 29/89 32%, Positives = 48/89 53%, Gaps = 4/89 4%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +  A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S 
Sbjct  30   SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 89
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I  + DC  V
Sbjct  90   LNAGNAASIPSKCGV---SIPYTISTSTDCSRV 119

Sequence Alignment: 15. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 54.4 bits 223,  Expect = 1e-09
 Identities = 35/90 38%, Positives = 49/90 54%, Gaps = 4/90 4%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC T+   L PC  F+ G+E  PSK CC+G   L+   KT   RV  C CI+   K+ + 
Sbjct  29   TCDTVQNILAPCAGFLTGQE--PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA- 85
Query  63   IDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGV 96
             D K +  +   CG V   +P +D N+DC  + V
Sbjct  86   YDPKRMPLLSTKCG-VKPDFPAVDKNLDCSKLPV 118

Sequence Alignment: 16. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 54.2 bits 222,  Expect = 1e-09
 Identities = 28/86 32%, Positives = 47/86 54%, Gaps = 4/86 4%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +  A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S 
Sbjct  30   SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 89
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 91
            ++    + +P  CG+    +P  I  + DC
Sbjct  90   LNAGNAASIPSKCGV---SIPYTISTSTDC 116

Sequence Alignment: 17. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 53.6 bits 219,  Expect = 2e-09
 Identities = 32/88 36%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PCL F++   + P+  CC+G K L+   KTGP R  AC C++T  K+  D
Sbjct  28   TCSDVSNKITPCLSFLKQGGEVPAD-CCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKD 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +       +P  CG+    +P  I +  DC TV
Sbjct  87   LKSDNAVVLPSKCGV---NIPYKISLETDCNTV 116

Sequence Alignment: 18. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 52.2 bits 212,  Expect = 4e-09
 Identities = 31/88 35%, Positives = 50/88 56%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   
Sbjct  2    TCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
            ++  L S +P  CG+ +  K+ P   + DC +V
Sbjct  61   VNFNLASGLPGKCGVSIPYKISP---STDCSSV 90

Sequence Alignment: 19. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 51.1 bits 207,  Expect = 1e-08
 Identities = 29/88 32%, Positives = 49/88 55%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +   + + +P  CG+    +P  I +  DC  V
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 20. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 51.1 bits 207,  Expect = 1e-08
 Identities = 29/88 32%, Positives = 49/88 55%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +   + + +P  CG+    +P  I +  DC  V
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 21. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 51.1 bits 207,  Expect = 1e-08
 Identities = 29/88 32%, Positives = 49/88 55%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +   + + +P  CG+    +P  I +  DC  V
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 22. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 51.1 bits 207,  Expect = 1e-08
 Identities = 36/87 41%, Positives = 50/87 57%, Gaps = 7/87 8%
Query  3    TCGTMVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
            TCGT+V  L PCL F++ G    P+  CC+G K L+ + KT P R  AC C++TA  + S
Sbjct  29   TCGTVVTRLTPCLTFLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSIS 86
Query  62   DIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
             I     + +   CG+    LP  I   +DC  V
Sbjct  87   GIQLGNAASLAGKCGV---NLPYKISPTIDCSKV 117

Sequence Alignment: 23. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 50.9 bits 206,  Expect = 1e-08
 Identities = 28/89 31%, Positives = 51/89 57%, Gaps = 4/89 4%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  AL+PCL +++     P   CC+G + ++   KT   R  AC+C+++A  +   
Sbjct  26   TCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKG 85
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++   V+ +P  CG+    +P  I ++ +C TV
Sbjct  86   LNPTTVAGLPGKCGV---NIPYKISLSTNCATV 115

Sequence Alignment: 24. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 50.1 bits 202,  Expect = 2e-08
 Identities = 29/88 32%, Positives = 51/88 57%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  +L PC+ +++     P+  CC+G + L+   KT   R  AC C+++A  +   
Sbjct  2    TCGQVSSSLAPCINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
            ++  L + +P  CG+ V  K+ P   + DCK+V
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISP---STDCKSV 90

Sequence Alignment: 25. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 49.9 bits 201,  Expect = 2e-08
 Identities = 28/88 31%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  AL PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   
Sbjct  2    TCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I  + +C TV
Sbjct  61   VNPNNAAALPGKCGV---HIPYKISASTNCATV 90

Sequence Alignment: 26. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 50.2 bits 203,  Expect = 2e-08
 Identities = 35/87 40%, Positives = 50/87 57%, Gaps = 7/87 8%
Query  3    TCGTMVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
            TCGT+V  L PCL +++ G    P+  CC+G K L+ + KT P R  AC C++TA  + S
Sbjct  29   TCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSIS 86
Query  62   DIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
             I     + +   CG+    LP  I   +DC  V
Sbjct  87   GIQLGNAASLAGKCGV---NLPYKISPTIDCSKV 117

Sequence Alignment: 27. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 50.0 bits 202,  Expect = 2e-08
 Identities = 30/88 34%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PCL +++ K  E    CC+G K L+  TKT P R  AC C++ + K+  D
Sbjct  26   TCSDVSTKISPCLSYLK-KGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 84
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +   +   +P  CG+    LP  + +  DC  V
Sbjct  85   LKSDFAVPLPSKCGL---NLPYKLSLETDCNKV 114

Sequence Alignment: 28. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 50.0 bits 202,  Expect = 2e-08
 Identities = 30/88 34%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PCL +++ K  E    CC+G K L+  TKT P R  AC C++ + K+  D
Sbjct  28   TCSDVSTKISPCLSYLK-KGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +   +   +P  CG+    LP  + +  DC  V
Sbjct  87   LKSDFAVPLPSKCGL---NLPYKLSLETDCNKV 116

Sequence Alignment: 29. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 49.8 bits 201,  Expect = 3e-08
 Identities = 30/88 34%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PCL F++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D
Sbjct  28   TCSDVSNKISPCLSFLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +       +P  CG+    +P  I +  DC  V
Sbjct  87   LKSDNAVVLPSKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 30. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 49.8 bits 201,  Expect = 3e-08
 Identities = 29/88 32%, Positives = 46/88 52%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +   L PCL ++ G    PS  CC G K+L     T P R  AC C+++A  + + 
Sbjct  28   SCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I    +C TV
Sbjct  87   LNTNNAAALPGKCGV---NIPYKISTTTNCNTV 116

Sequence Alignment: 31. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 49.6 bits 200,  Expect = 3e-08
 Identities = 33/88 37%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +   L  CL +++G    PS  CC G K L+   KT   R +AC C++T   +   
Sbjct  29   TCGQVTGKLGGCLGYLKGG-GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKG 87
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            I+    S +P  CGI   ++P PI  + DC  V
Sbjct  88   INYGAASALPGKCGI---RIPYPISPSTDCSRV 117

Sequence Alignment: 32. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 49.0 bits 197,  Expect = 3e-08
 Identities = 29/87 33%, Positives = 45/87 51%, Gaps = 5/87 5%
Query  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
            CG +   + PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   ++
Sbjct  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
Query  64   DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +      +P  CG+    LP  I +N+DC  V
Sbjct  62   NEDNARSIPPKCGV---NLPYTISLNIDCSRV 90

Sequence Alignment: 33. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 49.0 bits 197,  Expect = 4e-08
 Identities = 27/88 30%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  +L PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   
Sbjct  2    TCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I  + +C TV
Sbjct  61   VNPNNAAALPGKCGV---SIPYKISASTNCATV 90

Sequence Alignment: 34. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 49.4 bits 199,  Expect = 4e-08
 Identities = 30/88 34%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   ++PC  F++ +  E S  CC+G K L+   KT P R  AC C++T  K+  D
Sbjct  28   TCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
                    +P  CG+    +P  I +  DC  V
Sbjct  87   FKSDNAVVLPSKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 35. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 49.4 bits 199,  Expect = 4e-08
 Identities = 30/88 34%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   ++PC  F++ +  E S  CC+G K L+   KT P R  AC C++T  K+  D
Sbjct  28   TCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
                    +P  CG+    +P  I +  DC  V
Sbjct  87   FKSDNAVVLPSKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 36. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 49.4 bits 199,  Expect = 4e-08
 Identities = 29/89 32%, Positives = 49/89 55%, Gaps = 5/89 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEP-SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
            TCG +  +L  C+ + +G    P  + CC+G + L+   KT P R  AC C+++   + S
Sbjct  29   TCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSIS 88
Query  62   DIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
             I+  LV+  P  CG+ +  K+ P   + +C  V
Sbjct  89   GINYGLVAGAPGKCGVSIPYKIAP---STNCDNV 119

Sequence Alignment: 37. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 49.0 bits 197,  Expect = 5e-08
 Identities = 29/88 32%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +  AL PC+PF+  K   P   CCSG + L G  +T   R  AC C++ A  +   
Sbjct  26   SCGQVNSALAPCIPFLT-KGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRG 84
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  85   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 114

Sequence Alignment: 38. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 48.8 bits 196,  Expect = 5e-08
 Identities = 29/88 32%, Positives = 46/88 52%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PC  F++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D
Sbjct  28   TCSDVSNKISPCTSFLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
                  + +P  CG+    +P  I +  DC  V
Sbjct  87   FKSDNAAVLPSKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 39. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 48.6 bits 195,  Expect = 6e-08
 Identities = 28/88 31%, Positives = 46/88 52%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   + PCL +++   + P+  CC+G K L+   KT P R  AC C++ + KT  D
Sbjct  27   TCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +       +P  CG+    +P  + +  DC  V
Sbjct  86   LKSDYAVPLPSKCGVT---IPYKLSMETDCNKV 115

Sequence Alignment: 40. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 48.2 bits 193,  Expect = 6e-08
 Identities = 27/88 30%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CGT+   L  C+ ++      P KGCC+G   L+   +T P R +AC C+  A  ++  
Sbjct  3    SCGTVNSNLAACIGYLTQNAPLP-KGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPS 61
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +PK CG+    +P  I  + +C +V
Sbjct  62   LNAARAAALPKACGV---NIPYKISKSTNCNSV 91

Sequence Alignment: 41. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 48.4 bits 194,  Expect = 7e-08
 Identities = 29/88 32%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  + + + PC  F++ K  E    CC+G K L+   KT P R  AC C++T+ K+ ++
Sbjct  28   TCNDVTKKISPCTSFLE-KGGEVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNN 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
               +  + +P  CG+    +P  I +  DC  V
Sbjct  87   FKEENAAVLPSKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 42. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 47.8 bits 191,  Expect = 8e-08
 Identities = 30/88 34%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +  AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   
Sbjct  2    SCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 90

Sequence Alignment: 43. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 48.2 bits 193,  Expect = 9e-08
 Identities = 27/89 30%, Positives = 47/89 52%, Gaps = 5/89 5%
Query  3    TCGTMVRALMPCLPFVQGKEKE-PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
            +CGT+   + PC+ ++Q      P   CC+G K+L     T P R  AC C+++A  +  
Sbjct  28   SCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIP 87
Query  62   DIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
             ++    + +P  CG+    +P  I  + +C TV
Sbjct  88   KLNTNNAAALPGKCGV---SIPYKISTSTNCNTV 118

Sequence Alignment: 44. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 48.0 bits 192,  Expect = 1e-07
 Identities = 28/86 32%, Positives = 48/86 55%, Gaps = 7/86 8%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +  AL PC+ + +G    PS  CCSG + L    ++   +  AC+CI++A    + 
Sbjct  28   SCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNA 87
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
              GK  + +P  CG+    +P  I  ++DC  +
Sbjct  88   --GK-AAGIPTKCGV---SVPYAISSSVDCSKI 114

Sequence Alignment: 45. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 47.6 bits 190,  Expect = 1e-07
 Identities = 27/88 30%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  +L PC+ +V+G    P   CC+G + ++   +T P R  AC C++    + S 
Sbjct  2    TCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I  + +C TV
Sbjct  61   VNPNNAAALPGKCGV---NIPYKISASTNCATV 90

Sequence Alignment: 46. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 47.7 bits 191,  Expect = 1e-07
 Identities = 29/88 32%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +   + PCL +V+     P+  CCSG + L+G  KT   R  AC C++ A      
Sbjct  28   TCGQVASNISPCLTYVKSGGAVPA-ACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKG 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++  L + +P  CG+    +P  I    +C  V
Sbjct  87   LNPNLAAGLPGKCGV---SVPYKISTTTNCAAV 116

Sequence Alignment: 47. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 47.5 bits 190,  Expect = 1e-07
 Identities = 30/87 34%, Positives = 50/87 57%, Gaps = 9/87 10%
Query  3    TCGTMVRALMPCLPFV-QGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMK--T 59
            +CG +V  L PC+ +V  G    PS  CC+G + L    +T   R   C C++ A+    
Sbjct  32   SCGQVVNNLTPCINYVANGGALNPS--CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIP 89
Query  60   YSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
            Y++ +  L + +P  CG+ +  K+ P   + DCKT+
Sbjct  90   YTNANAGLAAGLPGKCGVNIPYKISP---STDCKTI 122

Sequence Alignment: 48. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 47.3 bits 189,  Expect = 1e-07
 Identities = 26/88 29%, Positives = 49/88 55%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG + + + PC+ +V+     P+  CC+G + L+ + KT   R + C C++ A  +   
Sbjct  28   TCGQVTQNVAPCFNYVKNGGAVPA-ACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPG 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++  L + +P  CG+    +P  I  + +C TV
Sbjct  87   LNPSLAAGLPGKCGV---SVPYKISTSTNCATV 116

Sequence Alignment: 49. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 47.1 bits 188,  Expect = 2e-07
 Identities = 27/87 31%, Positives = 45/87 51%, Gaps = 5/87 5%
Query  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
            C  +   +  CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D 
Sbjct  26   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 84
Query  64   DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
               + + +P  CG+    +P  I +  DC  V
Sbjct  85   KSDFAASLPSKCGV---NIPYKISLETDCNKV 113

Sequence Alignment: 50. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 47.1 bits 188,  Expect = 2e-07
 Identities = 27/87 31%, Positives = 45/87 51%, Gaps = 5/87 5%
Query  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
            C  +   +  CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D 
Sbjct  28   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  64   DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
               + + +P  CG+    +P  I +  DC  V
Sbjct  87   KSDFAASLPSKCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 51. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 47.1 bits 188,  Expect = 2e-07
 Identities = 27/87 31%, Positives = 45/87 51%, Gaps = 5/87 5%
Query  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
            C  +   +  CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D 
Sbjct  28   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  64   DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
               + + +P  CG+    +P  I +  DC  V
Sbjct  87   KSDFAASLPSKCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 52. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 46.5 bits 185,  Expect = 3e-07
 Identities = 26/88 29%, Positives = 44/88 50%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            +CG +  +L  C+PF+      P+  CCSG + L+   KT P R   C C+++A      
Sbjct  28   SCGQVTSSLASCIPFLTKGGPVPAS-CCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPG 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
             +      +P  CG+    +P  I  + +C T+
Sbjct  87   FNANNAGILPGKCGV---SIPYKISTSTNCATI 116

Sequence Alignment: 53. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 46.1 bits 183,  Expect = 3e-07
 Identities = 28/88 31%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TC  +   L PC+ +V+     P   CC+G K ++G  KT P R  AC C++    + S 
Sbjct  26   TCSQVSANLAPCINYVRSGGAVPP-ACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSG 84
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++      +P  CG+    +P  I  + +C TV
Sbjct  85   VNPGNAESLPGKCGV---NVPYKISTSTNCATV 114

Sequence Alignment: 54. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 45.9 bits 182,  Expect = 4e-07
 Identities = 27/88 30%, Positives = 46/88 52%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +   L PC+ +V+G    P   CC+G + ++   KT   R  AC C++    +   
Sbjct  28   TCGQVSSNLAPCIAYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACNCLKQLSASVPG 86
Query  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
            ++    + +P  CG+ V  K+ P   + +C TV
Sbjct  87   VNANNAAALPGKCGVNVPYKISP---STNCATV 116

Sequence Alignment: 55. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 45.7 bits 181,  Expect = 5e-07
 Identities = 26/88 29%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  +L PC+ +V+     P   CC+G + ++G  +T   R  AC C++    + S 
Sbjct  26   TCGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRTINGLARTTADRQTACNCLKNLAGSISG 84
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I  + +C TV
Sbjct  85   VNPNNAAGLPGKCGV---NVPYKISTSTNCATV 114

Sequence Alignment: 56. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 45.7 bits 181,  Expect = 5e-07
 Identities = 27/88 30%, Positives = 44/88 50%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +   + PC+ +V+     P+  CCSG + L+G  KT   R   C C++ A      
Sbjct  28   TCGQVASNISPCVTYVKSGGAVPAP-CCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKG 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++  L + +P  CG+    +P  I    +C  V
Sbjct  87   LNPNLAAGLPGKCGV---SVPYKISTTTNCAAV 116

Sequence Alignment: 57. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 44.2 bits 174,  Expect = 1e-06
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  ++ PC+ +V+     P+  CC+G + L+   KT   R   C C++ A      
Sbjct  28   TCGQVASSISPCVNYVKSGGAVPA-ACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKG 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++  L + +P  CG+    +P  I  + +C  V
Sbjct  87   LNPNLAAGLPGKCGV---NVPYKISTSTNCAAV 116

Sequence Alignment: 58. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 44.2 bits 174,  Expect = 1e-06
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +  ++ PC+ +V+     P+  CC+G + L+   KT   R   C C++ A      
Sbjct  28   TCGQVASSISPCVNYVKSGGAVPA-ACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKG 86
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++  L + +P  CG+    +P  I  + +C  V
Sbjct  87   LNPSLAAGLPGKCGV---SVPYKISTSTNCAAV 116

Sequence Alignment: 59. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 43.7 bits 171,  Expect = 1e-06
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +   L PC+ +V+G    P   CC+G + ++   +T   R  AC C++    +   
Sbjct  2    TCGQVSSNLAPCINYVKGGGAVPP-ACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++    + +P  CG+    +P  I  + +C TV
Sbjct  61   VNPNNAAALPGKCGV---NVPYKISASTNCATV 90

Sequence Alignment: 60. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 43.8 bits 172,  Expect = 2e-06
 Identities = 23/87 26%, Positives = 44/87 50%, Gaps = 5/87 5%
Query  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
            CG +   + PCL +VQG    PS  CC+G + L  + ++   R   C C++   +   ++
Sbjct  29   CGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNL 87
Query  64   DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            +    + +P  C +    +P  I  ++DC  +
Sbjct  88   NLNNAASIPSKCNV---NVPYTISPDIDCSRI 116

Sequence Alignment: 61. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 43.6 bits 171,  Expect = 2e-06
 Identities = 24/88 27%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +   L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      
Sbjct  26   TCGQVQSNLVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++      +P  CG+    +P  I  + +C ++
Sbjct  85   LNPNNAQALPGKCGV---NIPYKISTSTNCASI 114

Sequence Alignment: 62. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 43.2 bits 169,  Expect = 3e-06
 Identities = 23/84 27%, Positives = 43/84 51%, Gaps = 5/84 5%
Query  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
            CG +   + PCL +VQG    PS  CC+G + L  + ++   R   C C++   +   ++
Sbjct  29   CGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNL 87
Query  64   DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 91
            +    + +P  C +    +P  I  ++DC
Sbjct  88   NLNNAASIPSKCNV---NVPYTISPDIDC 113

Sequence Alignment: 63. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 42.4 bits 165,  Expect = 5e-06
 Identities = 25/88 28%, Positives = 43/88 48%, Gaps = 5/88 5%
Query  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
            TCG +   L  CL +++     P+  CC+G K +    KT P R  AC C++ A      
Sbjct  27   TCGQVTANLAQCLNYLRSGGAVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPG 85
Query  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            ++      +P  CG+    +P  I  + +C ++
Sbjct  86   LNPSNAGSLPGKCGV---NIPYKISTSTNCASI 115

Sequence Alignment: 64. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 42.0 bits 163,  Expect = 5e-06
 Identities = 24/85 28%, Positives = 49/85 57%, Gaps = 10/85 11%
Query  4    CGTMVRALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY- 60
            C  + +++ PC+ +++  G    P   CCSG + ++G  KT   R   C C+++A  +  
Sbjct  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  61   SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94
            S I+    + +P  CG+    +P  I  +++C ++
Sbjct  61   SQINPNNAASLPGKCGV---SIPYKISTSINCSSI 92

Sequence Alignment: 65. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 41.3 bits 160,  Expect = 9e-06
 Identities = 25/87 28%, Positives = 47/87 54%, Gaps = 7/87 8%
Query  3    TCGTMVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
            TC  +   L PC+ +++ G    PS  CC G + ++  ++T   R  AC C++   K  +
Sbjct  26   TCPQIKGNLTPCVLYLKNGGVLPPS--CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIA 83
Query  62   DIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94
             ++  L + +P  CG+ +  K+ P   + +C  V
Sbjct  84   GLNPNLAAGLPGKCGVNIPYKISP---STNCNNV 114

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.