The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC
CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEG
CQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATN
STLLAE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA34257 Tri a 18 186 1498 218.2 1.1e-58
AAA34258 Tri a 18 213 1433 209.3 6.3e-56
AAA34256 Tri a 18 212 1420 207.5 2.2e-55
P02877 Hev b 6.01 204 232 43.3 5.8e-06
Exo m 1.0101 40 206
P0DKH8 Fag e 4.0102 40 206 39.0 2.2e-05
Q8VXF1 Mus a 2.0101 318 211 40.6 5.9e-05
Q42428 Cas s 5 316 210 40.4 6.5e-05
CAC42881 Hev b 11.0101 295 206 39.8 9.1e-05
CAB01591 Pers a 1 326 204 39.6 0.00012
CAD24068 Hev b 11.0102 295 202 39.3 0.00013
P29022 Zea m 8.0101 280 186 37.1 0.00059
P81729 Bra r 2 91 158 32.7 0.0039
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 18 Sequence ID: AAA34257

 Score = 218.2 bits 1498,  Expect = 1e-58
 Identities = 186/186 100%, Positives = 186/186 100%, Gaps = 0/186 0%
Query  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC 60
            QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC
Sbjct  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC 60
Query  61   CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEG 120
            CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEG
Sbjct  61   CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEG 120
Query  121  CQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATN 180
            CQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATN
Sbjct  121  CQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATN 180
Query  181  STLLAE 186
            STLLAE
Sbjct  181  STLLAE 186

Sequence Alignment: 2. Allergen Name: Tri a 18 Sequence ID: AAA34258

 Score = 209.3 bits 1433,  Expect = 6e-56
 Identities = 176/186 94%, Positives = 179/186 96%, Gaps = 0/186 0%
Query  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC 60
            QRCGEQGS MECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGG TCPNNHC
Sbjct  28   QRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHC 87
Query  61   CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEG 120
            CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQ+GGKLCPNNLCCSQWG+CGLGSEFCG G
Sbjct  88   CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGG 147
Query  121  CQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATN 180
            CQ+GACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCD VFA AI  N
Sbjct  148  CQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDAVFAGAITAN 207
Query  181  STLLAE 186
            STLLAE
Sbjct  208  STLLAE 213

Sequence Alignment: 3. Allergen Name: Tri a 18 Sequence ID: AAA34256

 Score = 207.5 bits 1420,  Expect = 2e-55
 Identities = 175/186 94%, Positives = 179/186 96%, Gaps = 0/186 0%
Query  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC 60
            QRCGEQGS MECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGG TC NN+C
Sbjct  27   QRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCTNNQC 86
Query  61   CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEG 120
            CSQYG+CGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWG+CGLGSEFCG G
Sbjct  87   CSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGG 146
Query  121  CQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATN 180
            CQ+GACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAI  N
Sbjct  147  CQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAITAN 206
Query  181  STLLAE 186
            STLL E
Sbjct  207  STLLQE 212

Sequence Alignment: 4. Allergen Name: Hev b 6.01 Sequence ID: P02877

 Score = 43.3 bits 232,  Expect = 6e-06
 Identities = 34/61 55%, Positives = 41/61 67%, Gaps = 7/61 11%
Query  78   CQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCG--EGCQNGACSTDKPCGKD 135
            C  G   A+ +CG QAGGKLCPNNLCCSQWG+CG   E+C     CQ+  C   K  G+ 
Sbjct  10   CLTGVAIAE-QCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSN-C---KDSGEG 64
Query  136  AGGRVCTN 143
             GG   +N
Sbjct  65   VGGGSASN 72

Sequence Alignment: 5. Allergen Name: Exo Sequence ID:

 Score = 39.0 bits 206,  Expect = 2e-05
 Identities = 22/38 57%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  88   KCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGAC 126
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQ+  C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39

Sequence Alignment: 6. Allergen Name: Fag e 4.0102 Sequence ID: P0DKH8

 Score = 39.0 bits 206,  Expect = 2e-05
 Identities = 22/38 57%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  88   KCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGAC 126
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQ+  C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39

Sequence Alignment: 7. Allergen Name: Mus a 2.0101 Sequence ID: Q8VXF1

 Score = 40.6 bits 211,  Expect = 6e-05
 Identities = 27/51 52%, Positives = 34/51 66%, Gaps = 4/51 7%
Query  88   KCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCT 142
            +CG QAGG LCP  LCCSQ+G+CG    +CG+GCQ+  C      G   GG V +
Sbjct  21   QCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQGCQS-QCGGS---GGSGGGSVAS 71

Sequence Alignment: 8. Allergen Name: Cas s 5 Sequence ID: Q42428

 Score = 40.4 bits 210,  Expect = 6e-05
 Identities = 55/151 36%, Positives = 73/151 48%, Gaps = 31/151 20%
Query  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC 60
            ++CG Q  G  C NNLCCSQ+G+CG   +YCG GCQ+       +C S     + P    
Sbjct  19   EQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQS-------QCSSPTTTTSSPTA-- 69
Query  61   CSQYGHCGFGAEYCGAGC-QGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGS----- 114
             S  G    G+    +   Q    R D +C S   G    N +  +   + G+G+     
Sbjct  70   -SSGGGGDVGSLISASLFDQMLKYRNDPRCKS--NGFYTYNAFIAAARSFNGFGTTGDVT 126
Query  115  ----EFCGEGCQNGACSTD----KPCGKDAGGR--VCTNN---YCCSKWGSCGIGPGYCG 161
                E+     Q    +T      P G  A G   V  NN   YC SK   C  G  Y G
Sbjct  127  TRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSKSWPCVFGKQYYG 186
Query  162  AG 163
             G
Sbjct  187  RG 188

Sequence Alignment: 9. Allergen Name: Hev b 11.0101 Sequence ID: CAC42881

 Score = 39.8 bits 206,  Expect = 9e-05
 Identities = 27/48 56%, Positives = 33/48 68%, Gaps = 3/48 6%
Query  88   KCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGG 138
            +CG QAGG LCP  LCCSQ+G+C    E+CG GCQ+  C  D   G + GG
Sbjct  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QC--DGGGGGEDGG 49

Sequence Alignment: 10. Allergen Name: Pers a 1 Sequence ID: CAB01591

 Score = 39.6 bits 204,  Expect = 0.0001
 Identities = 29/55 52%, Positives = 36/55 65%, Gaps = 4/55 7%
Query  77   GCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACS--TDKPCG 133
            G   G   A+ +CG QAGG LCP  LCCSQ+G+CG  S++CG  CQ+  C   T  P G
Sbjct  17   GLLAGEAFAE-QCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQS-QCGGVTPSPGG 73

Sequence Alignment: 11. Allergen Name: Hev b 11.0102 Sequence ID: CAD24068

 Score = 39.3 bits 202,  Expect = 0.0001
 Identities = 53/154 34%, Positives = 66/154 42%, Gaps = 33/154 21%
Query  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQ---NGACWTSKRC---GSQAGGKT 54
            ++CG Q  G  CP  LCCSQYG+C    +YCG GCQ   +G       C   GS     T
Sbjct  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST 60
Query  55   CP------NNHCCSQYGHCGFGAEYCGA------GCQGG--PCRADIKC-------GSQA 93
                    NN  C   G   + A    A      G  G    C+ +I          +  
Sbjct  61   FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
Query  94   GGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPC--GKDAGGRVCTNNYCCSKWG 151
            G    P+      WGYC    E   +     + S   PC  GK   GR          +G
Sbjct  121  GWPTAPDG--PYAWGYCH--KEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYG 176
Query  152  SCGIGPG 158
             CG   G
Sbjct  177  QCGQALG 183

Sequence Alignment: 12. Allergen Name: Zea m 8.0101 Sequence ID: P29022

 Score = 37.1 bits 186,  Expect = 0.0006
 Identities = 28/60 46%, Positives = 36/60 60%, Gaps = 11/60 18%
Query  68   GFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACS 127
            G+ A  C A    GP  A   CG       C  N+CCS++GYCG    +CG+GCQ+G C 
Sbjct  11   GLLALLCAA---AGPAAAQ-NCG-------CQPNFCCSKFGYCGTTDAYCGDGCQSGPCR 59
Query  128  TDKPCGKDAGG 138
            +    G   GG
Sbjct  60   SGGGGGGGGGG 70

Sequence Alignment: 13. Allergen Name: Bra r 2 Sequence ID: P81729

 Score = 32.7 bits 158,  Expect = 0.004
 Identities = 25/56 44%, Positives = 31/56 55%, Gaps = 5/56 8%
Query  49   QAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIK--CGSQAGGKLCPNNLCCSQ 106
            QAGG+TC  N CCSQYG+CG  A+YC        C+A       +Q    L   +  CS 
Sbjct  1    QAGGQTCAGNICCSQYGYCGTTADYCSPD---NNCQATYHYYNPAQNNWDLRAVSAYCST 57
Query  107  W 107
            W
Sbjct  58   W 58

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.