The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN
EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY
NKLGMYPPNM
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB32652 Ole e 1.0101 130 886 256.8 1.4e-70
X76395 Ole e 1.0102 145 861 249.7 2e-68
CAA73037 Ole e 1.0106 146 859 249.2 3.1e-68
P19963 Ole e 1 145 858 248.9 3.7e-68
CAA73038 Ole e 1.0105 146 854 247.7 8.1e-68
CAA73036 Ole e 1.0107 146 845 245.2 4.8e-67
AAQ83588 Fra e 1.0201 146 811 235.6 3.8e-64
AAV74343 Fra e 1.0102 145 810 235.3 4.5e-64
AAQ08947 Fra e 1.0101 145 802 233.0 2.2e-63
X76396 Ole e 1.0103 145 801 232.7 2.7e-63
CAA54819 Lig v 1.0102 145 796 231.3 7.1e-63
X76397 Ole e 1.0104 145 792 230.2 1.6e-62
O82015 Lig v 1 145 786 228.5 5e-62
A0A0K1SC24 Aca f 1 150 359 107.6 1.3e-25
ADK22842 Sal k 5.0101 151 354 106.2 3.4e-25
AKV72167 Pro j 1.0101 150 333 100.3 2.1e-23
CAA33854 Lyc e LAT52 161 329 99.1 4.9e-23
AAL07319 Che a 1 168 325 98.0 1.1e-22
A0A0K1SC10 Ama r 1.0101 168 325 98.0 1.1e-22
A0A0K1SC44 Koc s 1.0101 167 276 84.1 1.7e-18
Q7M1X5 Lol p 11.0101 134 269 82.2 5.3e-18
AAN32987 Phl p 11.0101 143 260 79.6 3.3e-17
CAC41635 Pla l 1.0103 131 232 71.7 7.3e-15
P82242 Pla l 1 131 225 69.7 2.9e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 256.8 bits 886,  Expect = 1e-70
 Identities = 130/130 100%, Positives = 130/130 100%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  121  NKLGMYPPNM 130

Sequence Alignment: 2. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 249.7 bits 861,  Expect = 2e-68
 Identities = 124/130 95%, Positives = 128/130 98%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRAGFITELSEFIPGAS+RLQCK+K+NGD+TFTEVGYTRAEGLYSMLVERDHKN
Sbjct  16   QVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKN 75
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITLISSG KDCNEIPTEGW KPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY
Sbjct  76   EFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 135
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  136  NKLGMYPPNM 145

Sequence Alignment: 3. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 249.2 bits 859,  Expect = 3e-68
 Identities = 123/130 94%, Positives = 129/130 99%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRAGFITELSEFIPGASVRLQCK+K+NGD+TFTE+GYTRAEGLYSMLVERDHKN
Sbjct  17   QVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVERDHKN 76
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITLISSG KDCNEIPTEGWAKPSLKFIL+TVNGTTRTVNPLGF+KKEALPKCAQVY
Sbjct  77   EFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPLGFYKKEALPKCAQVY 136
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  137  NKLGMYPPNM 146

Sequence Alignment: 4. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 248.9 bits 858,  Expect = 4e-68
 Identities = 124/130 95%, Positives = 128/130 98%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRAGFITELSEFIPGAS+RLQCK+K+NGD+TFTEVGYTRAEGLYSMLVERDHKN
Sbjct  16   QVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKN 75
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITLISSG KDCNEIPTEGWAKPSLKF LNTVNGTTRTVNPLGFFKKEALPKCAQVY
Sbjct  76   EFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPLGFFKKEALPKCAQVY 135
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  136  NKLGMYPPNM 145

Sequence Alignment: 5. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 247.7 bits 854,  Expect = 8e-68
 Identities = 123/130 94%, Positives = 128/130 98%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRAGFITELSEFIPGASVRLQCK+K+NGD+TFTE+GYTRAEGLYSMLVERDHKN
Sbjct  17   QVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVERDHKN 76
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITLISSG KDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPL F+KKEALPKCAQVY
Sbjct  77   EFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLRFYKKEALPKCAQVY 136
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  137  NKLGMYPPNM 146

Sequence Alignment: 6. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 245.2 bits 845,  Expect = 5e-67
 Identities = 122/130 93%, Positives = 127/130 97%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCR+ FITELSEFIPGASVRLQC+EK+NGDITFTE+GYTRAEGLYSMLVERDHKN
Sbjct  17   QVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSMLVERDHKN 76
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITLISSG KDC+EIP EGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY
Sbjct  77   EFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 136
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  137  NKLGMYPPNM 146

Sequence Alignment: 7. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 235.6 bits 811,  Expect = 4e-64
 Identities = 114/130 87%, Positives = 124/130 95%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRA FIT+LSEFI GASVRLQC++K+NGD+TFTE+GYTR EGLYSM+VERDHKN
Sbjct  17   QVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMFVERDHKN 76
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITL+SSG KDCNEIP EGW KPSLKFILNTVNGTTRT+NPLGFFKKEALP+CAQVY
Sbjct  77   EFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPLGFFKKEALPQCAQVY 136
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  137  NKLGMYPPNM 146

Sequence Alignment: 8. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 235.3 bits 810,  Expect = 5e-64
 Identities = 115/130 88%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRAGFITELSEFI GA VRLQCKEK+NG +TFTEVGYTRAEGLYSM++ERDHKN
Sbjct  16   QVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTRAEGLYSMVIERDHKN 75
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEI L+SS  KDC+EIPTEGW KPSLKFILNTVNGTTRT+NPLGFFKKEALPKC QVY
Sbjct  76   EFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTTRTINPLGFFKKEALPKCPQVY 135
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  136  NKLGMYPPNM 145

Sequence Alignment: 9. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 233.0 bits 802,  Expect = 2e-63
 Identities = 113/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRAGFITELSEFI GA VRLQCK+K+NG +TFTEVGYTRAEGLYSM++ERDHKN
Sbjct  16   QVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVIERDHKN 75
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEI L+SS  KDC+EIPTEGW KPSLKFILNTVNGTTRT+NPLGFFKKE LPKC QVY
Sbjct  76   EFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPLGFFKKEVLPKCPQVY 135
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  136  NKLGMYPPNM 145

Sequence Alignment: 10. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 232.7 bits 801,  Expect = 3e-63
 Identities = 114/130 87%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRA FITELSEFIPGASVRLQCK+ +NG ITFTEVGYTRAEGLYSML+ERDHK+
Sbjct  16   QVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSMLIERDHKD 75
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITLISS  KDC+EIP EGW KPSLKF+LNTVNGTTRT+NPLGFFKKEALPKC QV+
Sbjct  76   EFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPLGFFKKEALPKCPQVF 135
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  136  NKLGMYPPNM 145

Sequence Alignment: 11. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 231.3 bits 796,  Expect = 7e-63
 Identities = 113/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRA FITELSEFIPGA VRLQCK+ +NG ITFTEVGYTRAEGLYSML+ERDHKN
Sbjct  16   QVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIERDHKN 75
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITL+SS  KDC+EIP EGW KPSLKF+LNTVNGTTRT+NPLGFFKKEALPKC QV+
Sbjct  76   EFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTTRTINPLGFFKKEALPKCPQVF 135
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  136  NKLGMYPPNM 145

Sequence Alignment: 12. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 230.2 bits 792,  Expect = 2e-62
 Identities = 112/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCR  FITE+SEFIPGA VRLQCK+ +NG ITFTEVGYTRAEGLYSML+ERDHKN
Sbjct  16   QVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIERDHKN 75
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITL+SS  KDC+EIPTEGW KPS+KFILNTVNGTTRT+NPLGFFKKEALPKC QV+
Sbjct  76   EFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPLGFFKKEALPKCPQVF 135
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  136  NKLGMYPPNM 145

Sequence Alignment: 13. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 228.5 bits 786,  Expect = 5e-62
 Identities = 110/130 84%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            QVYCDTCRA FITELSEFIPGA VRLQCK+ +NG +TFTEVGYT+AEGLY+ML+ERDHKN
Sbjct  16   QVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTKAEGLYNMLIERDHKN 75
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
            EFCEITLISS  KDC+EIPTEGW KPSLKF+LNTVNGTTRT+NPLGF+KKE LPKC QV+
Sbjct  76   EFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTTRTINPLGFLKKEVLPKCPQVF 135
Query  121  NKLGMYPPNM 130
            NKLGMYPPNM
Sbjct  136  NKLGMYPPNM 145

Sequence Alignment: 14. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 107.6 bits 359,  Expect = 1e-25
 Identities = 58/125 46%, Positives = 77/125 61%, Gaps = 4/125 3%
Query  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE 61
            VYCDTCR  FITE S  + GA+V+L+C+    G  TF     T   G YS+ V+ DH+++
Sbjct  17   VYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVDGDHEDD 76
Query  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT---RTVNPLGFFKKEALPKCAQ 118
             CEI L+ S    C+EIP + +AK S K  L + NG     R+ N LGF +KE LP+C +
Sbjct  77   ICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSANALGFMRKEPLPECPE 136
Query  119  VYN-KLGMY 126
            V   KL MY
Sbjct  137  VLKEKLDMY 145

Sequence Alignment: 15. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 106.2 bits 354,  Expect = 3e-25
 Identities = 52/125 41%, Positives = 78/125 62%, Gaps = 3/125 2%
Query  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE 61
            VYCDTCR  FIT +S  + GA+V LQC+    G  TF     T   G+Y++ V+ DH+++
Sbjct  15   VYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVDGDHEDD 74
Query  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT---RTVNPLGFFKKEALPKCAQ 118
             C+I L+ S  ++C+EIP + +++ + K  L + NG     R  N LGF+KK  LP+C +
Sbjct  75   ICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAPLPECPE 134
Query  119  VYNKLGMY 126
            V  +L MY
Sbjct  135  VLKELDMY 142

Sequence Alignment: 16. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 100.3 bits 333,  Expect = 2e-23
 Identities = 54/125 43%, Positives = 76/125 60%, Gaps = 4/125 3%
Query  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE 61
            VYCDTCR  F+T +S  + GA+V+L+C+    G  TF     T   G YS+ V  D +++
Sbjct  17   VYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDD 76
Query  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT---RTVNPLGFFKKEALPKCAQ 118
             CEI L+ S + DC+EIP + +AK S K  L + NG     R+ N LGF +KE L +C +
Sbjct  77   ICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEPLKECPE 136
Query  119  VYNK-LGMY 126
            V  + L MY
Sbjct  137  VSKEPLDMY 145

Sequence Alignment: 17. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 99.1 bits 329,  Expect = 5e-23
 Identities = 49/126 38%, Positives = 76/126 60%, Gaps = 2/126 1%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            +VYCDTCR  F T+LSE + GA+V+LQC+       TF+  G T  +G Y + V  DH+N
Sbjct  32   KVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVNGDHEN 91
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQV 119
            + CE+T++ S  +DC E    G+ K  ++   N  ++   R  NPL F K E++  C + 
Sbjct  92   DICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEA 150
Query  120  YNKLGMYP 127
             ++LG++P
Sbjct  151  LDELGLFP 158

Sequence Alignment: 18. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 98.0 bits 325,  Expect = 1e-22
 Identities = 50/125 40%, Positives = 75/125 60%, Gaps = 3/125 2%
Query  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE 61
            VYCDTCR  F+T +S  + GA+V+L+C+    G  TF     T   G YS+ V  D +++
Sbjct  36   VYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDD 95
Query  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT---RTVNPLGFFKKEALPKCAQ 118
             CEI L+ S + +C+E+  + +AK S K  L + NG     R+ N LGF +KE L +C +
Sbjct  96   ICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEPLKECPE 155
Query  119  VYNKLGMY 126
            V  +L +Y
Sbjct  156  VLKELDLY 163

Sequence Alignment: 19. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 98.0 bits 325,  Expect = 1e-22
 Identities = 50/125 40%, Positives = 75/125 60%, Gaps = 3/125 2%
Query  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE 61
            VYCDTCR  F+T +S  + GA+V+L+C+    G  TF     T   G YS+ V  D +++
Sbjct  36   VYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDD 95
Query  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT---RTVNPLGFFKKEALPKCAQ 118
             CEI L+ S + +C+E+  + +AK S K  L + NG     R+ N LGF +KE L +C +
Sbjct  96   ICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEPLEECPE 155
Query  119  VYNKLGMY 126
            V  +L +Y
Sbjct  156  VLKELDLY 163

Sequence Alignment: 20. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 84.1 bits 276,  Expect = 2e-18
 Identities = 47/122 38%, Positives = 72/122 59%, Gaps = 8/122 6%
Query  2    VYCDTCR--AGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHK 59
            VYCDTC   + ++  + E   GA+V+L+C+    G  TF     T   G YS+ V+ D +
Sbjct  36   VYCDTCPYPSSYVLPMLE---GATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVDGDFE 92
Query  60   NEFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT---RTVNPLGFFKKEALPKC 116
            ++ CEI L+ S    C+E+  + +AK S K  L + NG     R+ N LGF +KE L +C
Sbjct  93   DDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDVRSANALGFMRKEPLEEC 152
Query  117  AQVYNKLGMY 126
             +V  +L +Y
Sbjct  153  PEVLKELDLY 162

Sequence Alignment: 21. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 82.2 bits 269,  Expect = 5e-18
 Identities = 41/119 34%, Positives = 62/119 52%, Gaps = 1/119 0%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            +VYCD CRAGF T +S  + GA+V + C+    G+  +     T  +G Y + +++DH+ 
Sbjct  11   RVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEIDQDHQE 70
Query  61   EFCEITLISSGSKDCNEIPT-EGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQV 119
            E CE+ L  S  K C+EI      A+  L           R  NP+ FF+KE L +C  +
Sbjct  71   EICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLKECGGI 130

Sequence Alignment: 22. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 79.6 bits 260,  Expect = 3e-17
 Identities = 41/116 35%, Positives = 63/116 54%, Gaps = 7/116 6%
Query  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
            +VYCD CRAGF T +S  + GA+V + C+    G+  +     T   G Y + +++DH+ 
Sbjct  11   RVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEIDQDHQE 70
Query  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT----RTVNPLGFFKKEALPKC 116
            E CE+ L  S    C+EI      +   +  L + NG      R  NP+ FF+KE L +C
Sbjct  71   EICEVVLAKSPDTTCSEIEEF---RDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLKEC 127
Query  117  AQV 119
              +
Sbjct  128  GGI 130

Sequence Alignment: 23. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 71.7 bits 232,  Expect = 7e-15
 Identities = 46/112 41%, Positives = 67/112 59%, Gaps = 10/112 8%
Query  1    QVYCDTCRA-GFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHK 59
            +VYC+ C +  +I ELSE + GA V+L CK+     + ++  G T  +G+Y + V   H+
Sbjct  14   EVYCNVCHSRNLINELSERMAGAQVQLDCKDDSK-KVIYSIGGETGQDGVYRLPVVGYHE 72
Query  60   NEFCEITLISSGSKDCNEIP--TEGWAKPSLKFILN---TVNGTTRTVNPLGFFKKEALP 114
            +  CEI L+ SG  DC+EIP   +G  + S K  L+   T+   TR V PL F  K   P
Sbjct  73   D--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSFRAKTDAP 129
Query  115  KC 116
             C
Sbjct  130  GC 131

Sequence Alignment: 24. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 69.7 bits 225,  Expect = 3e-14
 Identities = 45/112 40%, Positives = 66/112 58%, Gaps = 10/112 8%
Query  1    QVYCDTCRA-GFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHK 59
            +VYC+ C +  +I ELSE + GA V+L CK+     + ++  G T  +G+Y + V   H+
Sbjct  14   EVYCNVCHSRNLINELSERMAGAQVQLDCKDDSK-KVIYSIGGETDQDGVYRLPVVGYHE 72
Query  60   NEFCEITLISSGSKDCNEIP--TEGWAKPSLKFILN---TVNGTTRTVNPLGFFKKEALP 114
            +  CEI L+ S   DC+EIP   +G  + S K  L+   T+   TR V PL F  K   P
Sbjct  73   D--CEIKLVKSSRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSFRAKTDAP 129
Query  115  KC 116
             C
Sbjct  130  GC 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.