The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK
GNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE
Sequence Info Allergen Name Length Opt Bits Score E Value
2JNZ_A Phl p 3.0101 108 742 182.7 1.9e-48
P93124 Dac g 3 96 597 148.6 3.2e-38
P14948 Lol p 3 97 541 135.4 3.1e-34
CAA90746 Tri a 3 118 496 124.7 6e-31
P14947 Lol p 2 97 438 111.1 6.2e-27
CAA51775 Lol p 2 88 384 98.4 3.7e-23
CAA10345 Dac g 2 122 384 98.3 5.4e-23
P43214 Phl p 2 122 384 98.3 5.4e-23
CAA10348 Poa p 2 122 384 98.3 5.4e-23
CAA10346 Cyn d 2 122 384 98.3 5.4e-23
AAF72991 Ory s 1 267 254 67.5 2.2e-13
AAF72983 Ory s 1 267 248 66.1 5.9e-13
Q40638 Ory s 1 263 230 61.9 1.1e-11
CAA10520 Poa p a 263 218 59.0 7.8e-11
O04701 Cyn d 1 246 217 58.8 8.5e-11
P43213 Phl p 1 263 216 58.6 1.1e-10
AAK96255 Cyn d 1.0201 244 215 58.4 1.2e-10
AAP80171 Cyn d 15 112 209 57.1 1.3e-10
A0A4D6G2J8 Uro m 1.0201 229 214 58.1 1.3e-10
AAL14079 Cyn d 1.0203 262 214 58.1 1.5e-10
A0A4D6FZ45 Uro m 1.0101 262 214 58.1 1.5e-10
AAL14077 Cyn d 1.0202 262 214 58.1 1.5e-10
AAF80379 Cyn d 1.0204 244 212 57.6 1.9e-10
CAA10140 Hol l 1 263 212 57.6 2.1e-10
AAA63279 Lol p 1.0101 263 212 57.6 2.1e-10
Q41260 Pha a 1 269 210 57.2 2.9e-10
P14946 Lol p 1 263 209 56.9 3.4e-10
AAA63278 Lol p 1.0102 252 208 56.7 3.8e-10
CAA93121 Hol l 1.0102 248 207 56.5 4.4e-10
P43216 Hol l 1 265 207 56.5 4.7e-10
ABC58726 Sor h 1.0101 239 203 55.5 8.1e-10
CAA81613 Phl p 1.0101 263 203 55.5 9e-10
QCX36431 Zoy m 1.0101 272 201 55.0 1.3e-09
CAB63699 Lol p 1.0103 263 200 54.8 1.5e-09
AAL14078 Cyn d 1 262 197 54.1 2.4e-09
P58738 Zea m 1 269 190 52.4 7.7e-09
ACA23876 Pas n 1.0101 265 189 52.2 8.9e-09
Q07154 Zea m 1 191 181 50.4 2.3e-08
AAF72984 Ory s 1 268 181 50.3 3.3e-08
AAF72990 Ory s 1 269 181 50.3 3.4e-08
AAF72986 Ory s 1 275 178 49.6 5.6e-08
AAD10496 Tri a ps93 271 174 48.7 1.1e-07
AAF72989 Ory s 1 271 169 47.5 2.4e-07
Q41183 Dac g 2 36 147 42.8 8.5e-07
AAA50175 Gly m 2 277 161 45.6 9.1e-07
A0A077B2S0 Sor h 2.0201 121 155 44.4 9.3e-07
AAF72987 Ory s 1 275 150 43.0 5.4e-06
AAB61710 Ory s 1 261 145 41.8 1.2e-05
A0A077B7S9 Sor h 2.0101 119 139 40.6 1.3e-05
AAF72985 Ory s 1 286 133 39.0 9.1e-05
AAF72988 Ory s 1 327 129 38.0 0.00021
AAG13596 Ory s 1 275 115 34.8 0.0017
AAB23303 Dac g 2 26 94 30.3 0.0034
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 182.7 bits 742,  Expect = 2e-48
 Identities = 108/108 100%, Positives = 108/108 100%, Gaps = 0/108 0%
Query  1    RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK 60
            RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK
Sbjct  1    RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK 60
Query  61   GNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108
            GNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE
Sbjct  61   GNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108

Sequence Alignment: 2. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 148.6 bits 597,  Expect = 3e-38
 Identities = 87/96 90%, Positives = 91/96 94%, Gaps = 0/96 0%
Query  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPL 72
            V+VTF V+KGSDPKKLVLDIKYTRPGD+LAEVELRQHGSEEWEPLTKKGN+WEVKSSKPL
Sbjct  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPL 60
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108
             GPFNFRFMSKGGMRNVFDEVIPTAF IG TY PEE
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96

Sequence Alignment: 3. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 135.4 bits 541,  Expect = 3e-34
 Identities = 76/94 80%, Positives = 88/94 93%, Gaps = 0/94 0%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLV 73
            +V +TV+KGSD K LVL+IKYTRPGD+LAEVELRQHGSEEWEP+TKKGN+WEVKS+KPL 
Sbjct  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPLT 61
Query  74   GPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPE 107
            GP NFRF+SKGGM+NVFDEVIPTAF++GKTY PE
Sbjct  62   GPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95

Sequence Alignment: 4. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 124.7 bits 496,  Expect = 6e-31
 Identities = 73/96 76%, Positives = 82/96 85%, Gaps = 0/96 0%
Query  12   AVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKP 71
            AV+V +TVQKGSD KKL L I YTRP DSL+EVELRQ+GSEEW+PLTKKG+VWEV  SKP
Sbjct  22   AVKVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKKGDVWEVSCSKP 81
Query  72   LVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPE 107
            LVGPFNFRF+SK GM+ VFDEV  T F IGKTY+PE
Sbjct  82   LVGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYEPE 117

Sequence Alignment: 5. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 111.1 bits 438,  Expect = 6e-27
 Identities = 63/96 65%, Positives = 75/96 78%, Gaps = 1/96 1%
Query  12   AVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGN-VWEVKSSK 70
            A  V FTV+KGSD K L L IKY + GDS+AEVEL++HGS EW  L K G+ VWE+KS K
Sbjct  1    AAPVEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDK 60
Query  71   PLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPE 107
            PL GPFNFRF+S+ GMRNVFD+V+P  F +G TYKPE
Sbjct  61   PLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE 97

Sequence Alignment: 6. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 98.4 bits 384,  Expect = 4e-23
 Identities = 54/85 63%, Positives = 68/85 80%, Gaps = 1/85 1%
Query  17   FTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGN-VWEVKSSKPLVGP 75
            FTV+KGSD K L L IKY++ GD++AEVEL++HGS EW  L K G+ VWE+KS KPL GP
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGP 61
Query  76   FNFRFMSKGGMRNVFDEVIPTAFSIG 101
            FNFRF+S+ GM NVFD+V+P  F +G
Sbjct  62   FNFRFVSEKGMWNVFDDVVPADFKVG 87

Sequence Alignment: 7. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 98.3 bits 384,  Expect = 5e-23
 Identities = 55/93 59%, Positives = 75/93 80%, Gaps = 3/93 3%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTK-KGNVWEVKSSKPL 72
            +VTFTV+KGS+ K L + +KY   GD++AEVELR+HGS+EW  +TK +G VW   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108
             GPFNFRF+++ GM+NVFD+V+P  ++IG TY PEE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE 122

Sequence Alignment: 8. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 98.3 bits 384,  Expect = 5e-23
 Identities = 55/93 59%, Positives = 75/93 80%, Gaps = 3/93 3%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTK-KGNVWEVKSSKPL 72
            +VTFTV+KGS+ K L + +KY   GD++AEVELR+HGS+EW  +TK +G VW   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108
             GPFNFRF+++ GM+NVFD+V+P  ++IG TY PEE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE 122

Sequence Alignment: 9. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 98.3 bits 384,  Expect = 5e-23
 Identities = 55/93 59%, Positives = 75/93 80%, Gaps = 3/93 3%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTK-KGNVWEVKSSKPL 72
            +VTFTV+KGS+ K L + +KY   GD++AEVELR+HGS+EW  +TK +G VW   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108
             GPFNFRF+++ GM+NVFD+V+P  ++IG TY PEE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE 122

Sequence Alignment: 10. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 98.3 bits 384,  Expect = 5e-23
 Identities = 55/93 59%, Positives = 75/93 80%, Gaps = 3/93 3%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTK-KGNVWEVKSSKPL 72
            +VTFTV+KGS+ K L + +KY   GD++AEVELR+HGS+EW  +TK +G VW   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108
             GPFNFRF+++ GM+NVFD+V+P  ++IG TY PEE
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE 122

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 67.5 bits 254,  Expect = 2e-13
 Identities = 36/94 38%, Positives = 59/94 62%, Gaps = 1/94 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            +VTF V+KGS+P  + + +KY      + +VEL++ GSEEW+PL +  G +W + + KPL
Sbjct  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPL 228
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPE 107
             GPF++R  ++   + V ++VIP  +     YK E
Sbjct  229  KGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 66.1 bits 248,  Expect = 6e-13
 Identities = 33/92 35%, Positives = 56/92 60%, Gaps = 1/92 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            ++TF ++K S+P  L L +KY      + EVE+++ GSEEW+ L +  G +W + + KPL
Sbjct  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
             GPF+ R  ++GG + + ++ IP  +     YK
Sbjct  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYK 261

Sequence Alignment: 13. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 61.9 bits 230,  Expect = 1e-11
 Identities = 31/82 37%, Positives = 52/82 63%, Gaps = 1/82 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            ++TF ++K S+P  L L +KY      + EVE+++ GSEEW+ L +  G +W + + KPL
Sbjct  166  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 225
Query  73   VGPFNFRFMSKGGMRNVFDEVIP 95
             GPF+ R  ++G  R+  ++ IP
Sbjct  226  KGPFSVRVTTEGARRSSAEDAIP 248

Sequence Alignment: 14. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 59.0 bits 218,  Expect = 8e-11
 Identities = 34/90 37%, Positives = 56/90 62%, Gaps = 3/90 3%
Query  14   QVTFTVQKGSDPKKLVLDIKY-TRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKP 71
            +VTF V+KGS+P  L L +KY T  GD +A V++++ G ++W  L +  G++W V +   
Sbjct  169  KVTFHVEKGSNPNYLALLVKYVTGDGDVVA-VDIKEKGKDKWIELKESWGSIWRVDTPDK 227
Query  72   LVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            L GPF  R+ ++GG +   ++VIP  +     Y
Sbjct  228  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 260

Sequence Alignment: 15. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 58.8 bits 217,  Expect = 8e-11
 Identities = 32/94 34%, Positives = 53/94 56%, Gaps = 1/94 1%
Query  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
            S  ++TF ++KGS+   L L +KY     ++  V+++   S+E+ P+    G +W +   
Sbjct  144  SGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPK 203
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            KPL GPF+ R+ S+GG   V D+VIP  +     Y
Sbjct  204  KPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVY 238

Sequence Alignment: 16. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 58.6 bits 216,  Expect = 1e-10
 Identities = 29/92 31%, Positives = 53/92 57%, Gaps = 1/92 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            +VTF V+KGS+P  L L +KY      +  V++++ G ++W  L +  G +W + +   L
Sbjct  169  KVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKL 228
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
             GPF  R+ ++GG +   ++VIP  +    +Y+
Sbjct  229  TGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYE 261

Sequence Alignment: 17. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 58.4 bits 215,  Expect = 1e-10
 Identities = 33/95 34%, Positives = 52/95 54%, Gaps = 1/95 1%
Query  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
            S  ++ F V+KGS P  L L +KY     ++  V+++  GS+E+ P+ +  G +W +   
Sbjct  144  SDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRIDPP 203
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            KPL GPF  R+ S+ G     D+VIP  +     YK
Sbjct  204  KPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYK 239

Sequence Alignment: 18. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 57.1 bits 209,  Expect = 1e-10
 Identities = 35/90 38%, Positives = 57/90 63%, Gaps = 6/90 6%
Query  9    HGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKS 68
            H   V + F V++ S PK + L IK +     + +V++R+HG++  +P+TK G+ W +  
Sbjct  16   HAWCVNIIFHVEESS-PK-FALSIKDS--AKEITQVDVREHGADNMDPMTKSGDSWTI-- 69
Query  69   SKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
             KPL GP+N R+ ++GG   V D+VIP  +  G  Y
Sbjct  70   DKPLKGPLNIRLRAEGGGSRVQDDVIPENWKAGTDY 105

Sequence Alignment: 19. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 58.1 bits 214,  Expect = 1e-10
 Identities = 32/91 35%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            ++ F V+KG +P  + L IKY      +  V++++ GSEE+ PL    G +W + S KP+
Sbjct  132  KIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAIWRIDSPKPI 191
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
             GP   R+ S+GG   V D+ IP  +     Y
Sbjct  192  KGPIAVRLTSEGGTTLVQDDAIPEGWKADTVY 223

Sequence Alignment: 20. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 58.1 bits 214,  Expect = 1e-10
 Identities = 32/95 33%, Positives = 53/95 55%, Gaps = 1/95 1%
Query  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
            S  ++ F V+KGS+P  L L +KY     ++  V+++  GS+E+ P+ +  G +W +   
Sbjct  162  SDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPP 221
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            KPL GPF  R+ S+ G     ++VIP  +     YK
Sbjct  222  KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257

Sequence Alignment: 21. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 58.1 bits 214,  Expect = 1e-10
 Identities = 32/95 33%, Positives = 53/95 55%, Gaps = 1/95 1%
Query  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
            S  ++ F V+KGS+P  L L +KY     ++  V+++  GS+E+ P+ +  G +W +   
Sbjct  162  SDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPP 221
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            KPL GPF  R+ S+ G     ++VIP  +     YK
Sbjct  222  KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257

Sequence Alignment: 22. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 58.1 bits 214,  Expect = 1e-10
 Identities = 32/95 33%, Positives = 53/95 55%, Gaps = 1/95 1%
Query  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
            S  ++ F V+KGS+P  L L +KY     ++  V+++  GS+E+ P+ +  G +W +   
Sbjct  162  SDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPP 221
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            KPL GPF  R+ S+ G     ++VIP  +     YK
Sbjct  222  KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257

Sequence Alignment: 23. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 57.6 bits 212,  Expect = 2e-10
 Identities = 33/95 34%, Positives = 52/95 54%, Gaps = 1/95 1%
Query  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
            S  ++ F V+KGS P  L L +KY     ++  V+++  GS+E+ P+ +  G +W +   
Sbjct  144  SDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPP 203
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            KPL GPF  R+ S+ G     D+VIP  +     YK
Sbjct  204  KPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYK 239

Sequence Alignment: 24. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 57.6 bits 212,  Expect = 2e-10
 Identities = 31/92 33%, Positives = 52/92 56%, Gaps = 1/92 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            +VTF V+KGS+P  L L +KY      +  V++++ G ++W  L +  G VW V +   L
Sbjct  169  KVTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKL 228
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
             GPF  R+ ++GG +   ++VIP  +     Y+
Sbjct  229  TGPFTVRYTTEGGTKVEAEDVIPEGWKADTAYE 261

Sequence Alignment: 25. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 57.6 bits 212,  Expect = 2e-10
 Identities = 28/89 31%, Positives = 51/89 57%, Gaps = 1/89 1%
Query  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
            TF V+K S+P  L + +KY      +  V++++ G ++W  L +  G VW + +   L G
Sbjct  171  TFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTG 230
Query  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            PF  R+ ++GG ++ F++VIP  +    +Y
Sbjct  231  PFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 26. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 57.2 bits 210,  Expect = 3e-10
 Identities = 28/80 35%, Positives = 48/80 60%, Gaps = 1/80 1%
Query  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
            TF V+KGS+P  L L +KY      +  V++++ G ++W  L +  G +W + +   L G
Sbjct  177  TFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTG 236
Query  75   PFNFRFMSKGGMRNVFDEVIP 95
            PF  R+ ++GG +  F++VIP
Sbjct  237  PFTVRYTTEGGTKAEFEDVIP 257

Sequence Alignment: 27. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 56.9 bits 209,  Expect = 3e-10
 Identities = 28/89 31%, Positives = 51/89 57%, Gaps = 1/89 1%
Query  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
            TF V+K S+P  L + +KY      +  V++++ G ++W  L +  G VW + +   L G
Sbjct  171  TFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTG 230
Query  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            PF  R+ ++GG ++ F++VIP  +    +Y
Sbjct  231  PFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 28. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 56.7 bits 208,  Expect = 4e-10
 Identities = 28/89 31%, Positives = 51/89 57%, Gaps = 1/89 1%
Query  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
            TF V+KGS+P  L + +KY      +  V++++ G ++W  L +  G VW + +   L G
Sbjct  160  TFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTG 219
Query  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            PF  R+ ++GG ++  ++VIP  +    +Y
Sbjct  220  PFTVRYTTEGGTKSEVEDVIPEGWKADTSY 249

Sequence Alignment: 29. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 56.5 bits 207,  Expect = 4e-10
 Identities = 30/90 33%, Positives = 50/90 55%, Gaps = 1/90 1%
Query  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
            TF V+KGS+P  L L +KY      +  V++++ G ++W  L +  G VW V +   L G
Sbjct  156  TFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTG 215
Query  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            PF  R+ ++GG +   ++VIP  +     Y+
Sbjct  216  PFTVRYTTEGGTKGEAEDVIPEGWKADTAYE 246

Sequence Alignment: 30. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 56.5 bits 207,  Expect = 5e-10
 Identities = 30/90 33%, Positives = 50/90 55%, Gaps = 1/90 1%
Query  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
            TF V+KGS+P  L L +KY      +  V++++ G ++W  L +  G VW V +   L G
Sbjct  173  TFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTG 232
Query  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            PF  R+ ++GG +   ++VIP  +     Y+
Sbjct  233  PFTVRYTTEGGTKGEAEDVIPEGWKADTAYE 263

Sequence Alignment: 31. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 55.5 bits 203,  Expect = 8e-10
 Identities = 29/91 31%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            +VTF V+KGS+P  L L +KY      +  V++++ G + ++PL    G +W   S  P+
Sbjct  145  KVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGGDAYQPLKHSWGAIWRKDSPDPI 204
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
              P   +  ++GG +  +D+VIP  +    TY
Sbjct  205  KFPVTVQITTEGGTKTAYDDVIPEGWKADTTY 236

Sequence Alignment: 32. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 55.5 bits 203,  Expect = 9e-10
 Identities = 28/92 30%, Positives = 52/92 56%, Gaps = 1/92 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            +VTF V+KGS+P  L L +K+      +  V++++ G ++W  L +  G +W + + + L
Sbjct  169  KVTFHVEKGSNPNYLALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVL 228
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
             GPF  R+ ++GG +    +VIP  +     Y+
Sbjct  229  KGPFTVRYTTEGGTKGEAKDVIPEGWKADTAYE 261

Sequence Alignment: 33. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 55.0 bits 201,  Expect = 1e-09
 Identities = 30/94 31%, Positives = 51/94 54%, Gaps = 1/94 1%
Query  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
            S  ++TF V+KG +   L L ++Y      +  V+++  GS+E+ P+    G +W +   
Sbjct  172  SKTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPK 231
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            KPL GPF  R+ S+ G + V ++VIP  +     Y
Sbjct  232  KPLKGPFTVRLTSESGAKLVQEDVIPADWKPNTAY 266

Sequence Alignment: 34. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 54.8 bits 200,  Expect = 1e-09
 Identities = 27/89 30%, Positives = 50/89 56%, Gaps = 1/89 1%
Query  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
            TF V+K S+P  L + +KY      +  V++++ G ++W  L +  G VW + +   L G
Sbjct  171  TFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTG 230
Query  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            PF  R+ ++GG ++  ++VIP  +    +Y
Sbjct  231  PFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260

Sequence Alignment: 35. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 54.1 bits 197,  Expect = 2e-09
 Identities = 32/95 33%, Positives = 51/95 53%, Gaps = 1/95 1%
Query  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
            S  ++TF V+KGS P  L L +KY     ++  V+++  GS+ + P+    G +W +   
Sbjct  162  SDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPP 221
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            KPL GPF  R+ S+ G     ++VIP  +     YK
Sbjct  222  KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257

Sequence Alignment: 36. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 52.4 bits 190,  Expect = 8e-09
 Identities = 26/91 28%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            ++ F ++KG +P  L + +KY      +  +E++   S EW+P+    G +W + ++K L
Sbjct  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
             GPF+ R+ S+ G + +  +VIP  +     Y
Sbjct  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVY 262

Sequence Alignment: 37. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 52.2 bits 189,  Expect = 9e-09
 Identities = 27/90 30%, Positives = 51/90 56%, Gaps = 2/90 2%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            ++ F V+KGS+P  L + +K+      +  +EL++  S+ W+P+    G +W + + K L
Sbjct  169  KIVFHVEKGSNPNYLAMLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKAL 227
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            V PF+ R+ S+ G + +  +VIP  +     Y
Sbjct  228  VPPFSIRLTSESGKKVIAQDVIPVNWKPDTVY 259

Sequence Alignment: 38. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 50.4 bits 181,  Expect = 2e-08
 Identities = 23/91 25%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            ++ F ++KG +P  + + +K+      +  +E++   S EW+P+    G +W + ++K L
Sbjct  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
             GPF+ R+ S+ G + +  ++IP  +     Y
Sbjct  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVY 184

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 50.3 bits 181,  Expect = 3e-08
 Identities = 26/93 27%, Positives = 55/93 59%, Gaps = 1/93 1%
Query  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKP 71
            ++VTF V++GS+P  + + ++Y      + +V+L +  S+ W P+ +  G++W + S+  
Sbjct  168  LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHR 227
Query  72   LVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            L  PF++R  ++ G + V  +VIP  ++    Y+
Sbjct  228  LTAPFSLRITNESGKQLVASQVIPANWAPMAVYR 261

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 50.3 bits 181,  Expect = 3e-08
 Identities = 25/82 30%, Positives = 47/82 57%, Gaps = 1/82 1%
Query  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
            +VTF V+KGS+P  L + +K+      + +++L++ G   W P+    G +W + ++ PL
Sbjct  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPL 230
Query  73   VGPFNFRFMSKGGMRNVFDEVIP 95
              PF+ R  ++ G   +  +VIP
Sbjct  231  KAPFSIRVTTESGKSLIAKDVIP 253

Sequence Alignment: 41. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 49.6 bits 178,  Expect = 6e-08
 Identities = 32/94 34%, Positives = 50/94 53%, Gaps = 4/94 4%
Query  12   AVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVE-LRQHGSEEWEPLTKK-GNVWEVKSS 69
            A+ V F V  GS+P  L + ++Y      LA V  ++  G   W+ + +  G  W + S+
Sbjct  171  AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSN 230
Query  70   --KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
              KPL  PF+ R+ S  G   V + VIP+ +  G TY+
Sbjct  231  TGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYR 268

Sequence Alignment: 42. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 48.7 bits 174,  Expect = 1e-07
 Identities = 29/92 31%, Positives = 52/92 56%, Gaps = 5/92 5%
Query  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQ--HGSEE--WEPLTKK-GNVWEVK 67
            ++VTF VQ+GS+P  L + ++Y     ++  +EL Q  +G     W+ + +  G+VW + 
Sbjct  168  MKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMD 227
Query  68   SSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            +++P+ GPF+ R  S  G   V +  IP  +     Y
Sbjct  228  TNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAY 264

Sequence Alignment: 43. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 47.5 bits 169,  Expect = 2e-07
 Identities = 29/93 31%, Positives = 52/93 55%, Gaps = 3/93 3%
Query  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSE--EWEPLTKK-GNVWEVKSS 69
            ++V F V++GS P  L + ++Y      +A+V+L++ G+    W P+ +  G+VW + S+
Sbjct  169  LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN 228
Query  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
              L  PF+ R  S  G   V  +VIP  ++    Y+
Sbjct  229  HRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYR 264

Sequence Alignment: 44. Allergen Name: Dac g 2 Sequence ID: Q41183

 Score = 42.8 bits 147,  Expect = 9e-07
 Identities = 23/33 69%, Positives = 27/33 81%, Gaps = 0/33 0%
Query  15   VTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELR 47
            VTFTV+KGSD K L L IKY + GDS+AEVEL+
Sbjct  4    VTFTVEKGSDEKNLALSIKYNKEGDSMAEVELK 36

Sequence Alignment: 45. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 45.6 bits 161,  Expect = 9e-07
 Identities = 27/91 29%, Positives = 50/91 54%, Gaps = 3/91 3%
Query  15   VTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQH-GSEEWEPLTKK-GNVWEVKSSKPL 72
            + F V  GS+ + +   ++Y      LA+VEL++   S  W+ + +  G VW+     PL
Sbjct  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
Query  73   VGPFNFRFMS-KGGMRNVFDEVIPTAFSIGKTYK 105
              PF+ ++ + + G   V + VIP  ++ G+TY+
Sbjct  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYR 270

Sequence Alignment: 46. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 44.4 bits 155,  Expect = 9e-07
 Identities = 28/90 31%, Positives = 47/90 52%, Gaps = 5/90 5%
Query  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGN--VWEVKSSKPLV 73
            T+T++ G D     L +       +++EV ++  G+ ++    K+     + + S +P+ 
Sbjct  28   TLTIEVGKDSTSTKLSLI---TNVAISEVSVKPKGATDFTDDLKESEPKTFTLDSKEPIE 84
Query  74   GPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108
            GP  FRF++KGG   V D  IP  F  G  YK  E
Sbjct  85   GPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTE 119

Sequence Alignment: 47. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 43.0 bits 150,  Expect = 5e-06
 Identities = 26/93 27%, Positives = 51/93 54%, Gaps = 7/93 7%
Query  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEE------WEPLTKK-GNVWE 65
            +++ F V++GS+P  + + ++Y      + +V+L +  S        W P+ +  G++W 
Sbjct  170  LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWR 229
Query  66   VKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            + S+  L  PF++R  S  G   V + VIP  +S    Y+
Sbjct  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYR 269

Sequence Alignment: 48. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 41.8 bits 145,  Expect = 1e-05
 Identities = 23/96 23%, Positives = 53/96 55%, Gaps = 8/96 8%
Query  7    HHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQ-----HGSEEWEPLTKK- 60
            +H G  + V F V+ GS+P  L + +++     ++ ++++ +       +  W P+ +  
Sbjct  153  YHRG--LYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSW 210
Query  61   GNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            G++W + ++  L GP ++R +S+ G   +  +VIP  +     Y
Sbjct  211  GSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254

Sequence Alignment: 49. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 40.6 bits 139,  Expect = 1e-05
 Identities = 29/89 32%, Positives = 49/89 55%, Gaps = 7/89 7%
Query  15   VTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKG--NVWEVKSSKPL 72
            +T+T+ K S   +LVL        D ++EV ++  G+ ++    K+     +  +S +P+
Sbjct  27   MTWTIGKDSTSTRLVL----VASAD-VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPI 81
Query  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108
             GP++ RF  KG      D+VIP  F  G  YK +E
Sbjct  82   KGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKE 117

Sequence Alignment: 50. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 39.0 bits 133,  Expect = 9e-05
 Identities = 23/93 24%, Positives = 52/93 55%, Gaps = 7/93 7%
Query  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQ----HG--SEEWEPLTKK-GNVWE 65
            +++ F V++ S+P  + + ++Y      + +V+L +    HG  + +W P+ +  G++W 
Sbjct  181  LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR 240
Query  66   VKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105
            + ++  L  PF+ R  ++ G   V + VIP  +     Y+
Sbjct  241  LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYR 280

Sequence Alignment: 51. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 38.0 bits 129,  Expect = 0.0002
 Identities = 27/90 30%, Positives = 53/90 58%, Gaps = 11/90 12%
Query  15   VTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQH--------GSEE--WEPLTKK-GNV 63
            VTF V++GS+P  + + ++Y      + +V+L +         G+    W P+ +  G++
Sbjct  220  VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSI 279
Query  64   WEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104
            W + ++ PL GPF++R  ++ G   + D+VIP  +     Y
Sbjct  280  WRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVY 320

Sequence Alignment: 52. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 34.8 bits 115,  Expect = 0.002
 Identities = 22/83 26%, Positives = 42/83 50%, Gaps = 7/83 8%
Query  20   QKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVGPFNF 78
            +K   P++L +   Y      +  V++   GS  W+ +T+  G  W   +++   GP+ F
Sbjct  165  EKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQF 222
Query  79   RFMSKGGMRNVF----DEVIPTAFSIGKTY 104
            R +  GG    +     EV+P  ++ G+ Y
Sbjct  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252

Sequence Alignment: 53. Allergen Name: Dac g 2 Sequence ID: AAB23303

 Score = 30.3 bits 94,  Expect = 0.003
 Identities = 15/22 68%, Positives = 17/22 77%, Gaps = 0/22 0%
Query  15   VTFTVQKGSDPKKLVLDIKYTR 36
            VTFTV+KGSD K L L IKY +
Sbjct  4    VTFTVEKGSDEKNLALSIKYNK 25

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.