The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

RGVQSSGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGP
CKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDK
NPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDG
IHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVR
GITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSR
QAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCS
NVKPTFSGKQVPAIKCA
Sequence Info Allergen Name Length Opt Bits Score E Value
Q6H9K0 Pla a 2 377 2571 592.4 1e-170
ABY21306 Pla or 2.0101 378 2139 494.0 4.6e-141
ARS33724 Sal k 6.0101 401 1237 288.3 3.9e-79
AHL24657 Sal k 6.0101 379 1232 287.2 8e-79
A0A077B569 Sor h 13.0201 410 1165 271.9 3.5e-74
CAB42886 Phl p 13 394 1163 271.5 4.6e-74
A0A077B155 Sor h 13.0101 422 1148 268.0 5.3e-73
W8PPL3 Ole e 14.0101 379 1061 248.2 4.3e-67
C9EA45 Cari p 1.0101 494 915 214.9 6.2e-57
P43212 Cry j 2 514 897 210.8 1.1e-55
BAA06172 Cry j 2 514 893 209.9 2.1e-55
Q7M1E7 Cha o 2.0101 514 889 209.0 3.9e-55
CAC05582 Jun a 2 507 873 205.3 4.8e-54
C0HKB1 Cup s 2.0101 164 150 41.0 4.5e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pla a 2 Sequence ID: Q6H9K0

 Score = 592.4 bits 2571,  Expect = 1e-170
 Identities = 377/377 100%, Positives = 377/377 100%, Gaps = 0/377 0%
Query  1    RGVQSSGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGP 60
            RGVQSSGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGP
Sbjct  1    RGVQSSGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGP 60
Query  61   CKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDK 120
            CKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDK
Sbjct  61   CKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDK 120
Query  121  NPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDG 180
            NPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDG
Sbjct  121  NPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDG 180
Query  181  IHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVR 240
            IHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVR
Sbjct  181  IHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVR 240
Query  241  GITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSR 300
            GITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSR
Sbjct  241  GITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSR 300
Query  301  QAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCS 360
            QAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCS
Sbjct  301  QAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCS 360
Query  361  NVKPTFSGKQVPAIKCA 377
            NVKPTFSGKQVPAIKCA
Sbjct  361  NVKPTFSGKQVPAIKCA 377

Sequence Alignment: 2. Allergen Name: Pla or 2.0101 Sequence ID: ABY21306

 Score = 494.0 bits 2139,  Expect = 5e-141
 Identities = 297/377 78%, Positives = 339/377 89%, Gaps = 0/377 0%
Query  1    RGVQSSGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGP 60
            RGVQSSG  FNVNDYGAKG+GDISQAVMKAW+AACAS GPSTVLIP GNY MGEV ++GP
Sbjct  2    RGVQSSGGTFNVNDYGAKGSGDISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGP 61
Query  61   CKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDK 120
            CKGSKIGFQ+DGVVKAPAD S FKS+GWV F  +DGLTVSG GT+DGQGQ AWA NNCDK
Sbjct  62   CKGSKIGFQLDGVVKAPADVSAFKSEGWVVFNHVDGLTVSGKGTFDGQGQKAWAANNCDK 121
Query  121  NPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDG 180
            + NC    MN+RF+FLK+A+VRDITS+NSKMFHINVLEC++I+FQHVT++APGTSINTDG
Sbjct  122  DENCNRPPMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTDG 181
Query  181  IHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVR 240
            IH+G+S+GVTIT+T IATGDDC+SIGPGSQNVT+T+VNCGPGHGIS+GSLG+Y +EK+VR
Sbjct  182  IHIGLSRGVTITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDVR 241
Query  241  GITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSR 300
            GITV GCTF+GT NGVRVKTWP+SPPG ATD+ F+DLTM NVQNPVILDQEYCPYGQCS 
Sbjct  242  GITVTGCTFTGTSNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQCSL 301
Query  301  QAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCS 360
            +APSR+KLSNI FNNIRGTS+G  A+VIACSHG PCSN++IGEINL+   AG PA STC+
Sbjct  302  KAPSRVKLSNIKFNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANSTCT 361
Query  361  NVKPTFSGKQVPAIKCA 377
            N KP FSGKQVPAIKCA
Sbjct  362  NAKPIFSGKQVPAIKCA 378

Sequence Alignment: 3. Allergen Name: Sal k 6.0101 Sequence ID: ARS33724

 Score = 288.3 bits 1237,  Expect = 4e-79
 Identities = 170/368 46%, Positives = 251/368 68%, Gaps = 9/368 2%
Query  4    QSSGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKG 63
            +S G + ++  +GAK   D + A++ AWK ACA+  P+ +++P G + +  V +QGPCK 
Sbjct  21   RSQGPI-DITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCK- 78
Query  64   SKIGFQIDGVVKAPADPSKFKS-DGWVSFYRIDGLTVSGT---GTLDGQGQTAWAKNNCD 119
            + +  +I G  KAPAD ++ K  D WV    + GLT++     GT+DGQGQ AW +N C 
Sbjct  79   APLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCA 138
Query  120  KNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTD 179
            ++  C     N+RF+ L +A +  I SLNSK++H+ V+ C++IT+  +T+ AP  S+NTD
Sbjct  139  QSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 198
Query  180  GIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEV 239
            G+H+G S GV  TN+KI TGDDCIS+G G+ +V +  + CGPGHGISIGS+G++ NE   
Sbjct  199  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 258
Query  240  RGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCS 299
             GI VK C+F+ T NGVR+K+W NS   +A+DL F+D+T+ NV NPVI+DQEYCPY +C 
Sbjct  259  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 318
Query  300  RQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTC 359
             + PS++KLS I+F N+ G +     V + CS  +PC  +++ +I+L++   GG A S C
Sbjct  319  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTF--PGGAAVSQC 376
Query  360  SNVKPTFSGKQVPAIKC 376
             NVKP  +GKQ P + C
Sbjct  377  KNVKPIVTGKQNP-VAC 392

Sequence Alignment: 4. Allergen Name: Sal k 6.0101 Sequence ID: AHL24657

 Score = 287.2 bits 1232,  Expect = 8e-79
 Identities = 168/362 46%, Positives = 247/362 68%, Gaps = 8/362 2%
Query  11   NVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSKIGFQI 70
            ++  +GAK   D + A++ AWK ACA+  P+ +++P G + +  V +QGPCK + +  +I
Sbjct  5    DITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCK-APLTIEI 63
Query  71   DGVVKAPADPSKFKS-DGWVSFYRIDGLTVSGT---GTLDGQGQTAWAKNNCDKNPNCKH 126
             G  KAPAD ++ K  D WV    + GLT++     GT+DGQGQ AW +N C ++  C  
Sbjct  64   AGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGMCNS 123
Query  127  AAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGIS 186
               N+RF+ L +A +  I SLNSK++H+ V+ C++IT+  +T+ AP  S+NTDG+H+G S
Sbjct  124  LPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHIGRS 183
Query  187  KGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKG 246
             GV  TN+KI TGDDCIS+G G+ +V +  + CGPGHGISIGS+G++ NE    GI VK 
Sbjct  184  NGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIFVKN 243
Query  247  CTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAPSRI 306
            C+F+ T NGVR+K+W NS   +A+DL F+D+T+ NV NPVI+DQEYCPY +C  + PS++
Sbjct  244  CSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTPSKV 303
Query  307  KLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTF 366
            KLS I+F N+ G +     V + CS  +PC  +++ +I+L++   GG A S C NVKP  
Sbjct  304  KLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTF--PGGAAVSQCKNVKPIV 361
Query  367  SGKQVPAIKC 376
            +GKQ P + C
Sbjct  362  TGKQNP-VAC 370

Sequence Alignment: 5. Allergen Name: Sor h 13.0201 Sequence ID: A0A077B569

 Score = 271.9 bits 1165,  Expect = 3e-74
 Identities = 162/366 44%, Positives = 238/366 65%, Gaps = 5/366 1%
Query  1    RGVQSSGSVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQ 58
            +     G  F+++  GA G G  D ++AV +AW +AC   G  T+LIPKG+Y +G +   
Sbjct  34   KAASGPGGSFDISKLGASGDGKKDSTKAVQEAWTSACGGTGKQTILIPKGDYLVGPLNFT 93
Query  59   GPCKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNC 118
            GPCKG  +  Q+DG + A  D S++K + W+   R+D L ++G G LDGQG   W+KN+C
Sbjct  94   GPCKGD-VTIQVDGNLLATTDLSQYKGN-WIEILRVDNLVITGKGKLDGQGPAVWSKNSC 151
Query  119  DKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINT 178
             K  +CK    +L +D++ +  V  IT LN+K FH+NV++C+ +T + VTVTAPG S NT
Sbjct  152  AKKYDCKILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNT 211
Query  179  DGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKE 238
            DGIH+G S  VTIT T I  GDDCISIGPGS  + +T V CGPGHGIS+GSLGRY +EK+
Sbjct  212  DGIHIGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKD 271
Query  239  VRGITVKGCTFSGTMNGVRVKTWPNSP-PGAATDLTFQDLTMNNVQNPVILDQEYCPYGQ 297
            V  I VK CT+  T NGVR+K++ ++     A+ L ++++ M++V NP+I+D +YCP   
Sbjct  272  VTDINVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKI 331
Query  298  CSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATS 357
            C+ +  S++ + ++ F NI GTS+   AV + CS  +PCS + +  I + Y+G      +
Sbjct  332  CTAKGDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMA 391
Query  358  TCSNVKPTFSG 368
             C N K + +G
Sbjct  392  VCQNAKGSATG 402

Sequence Alignment: 6. Allergen Name: Phl p 13 Sequence ID: CAB42886

 Score = 271.5 bits 1163,  Expect = 5e-74
 Identities = 167/374 44%, Positives = 245/374 65%, Gaps = 8/374 2%
Query  2    GVQSSGS--VFNVNDYGAK--GAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAM 57
            G  +SG+   +++   GAK  G  D ++ V +AW +AC   G +T++IPKG++  G +  
Sbjct  14   GDAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNF 73
Query  58   QGPCKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNN 117
             GPCKG  +  ++DG + +  D +K+K++ W+   RI  LT++G GTLDGQG+  W KN+
Sbjct  74   TGPCKGDSVTIKLDGNLLSSNDLAKYKAN-WIEIMRIKKLTITGKGTLDGQGKAVWGKNS 132
Query  118  CDKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSIN 177
            C KN NCK     L +DF   A++  IT LN+K FH+N+ EC+ +T + VT+TAPG S N
Sbjct  133  CAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPN 192
Query  178  TDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEK 237
            TDGIH+G S  VTIT+T I TGDDCISIGPGS  + IT V CGPGHGIS+GSLGRY +EK
Sbjct  193  TDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEK 252
Query  238  EVRGITVKGCTFSGTMNGVRVKTWPNSP-PGAATDLTFQDLTMNNVQNPVILDQEYCPYG 296
            +V  ITVK C +  + NG+R+K++ ++  P  A+ LT++++ M +V  P+I+DQ+YCP  
Sbjct  253  DVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNK 312
Query  297  QCSRQAPS-RIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPA 355
             C+ +  S R+ + ++ F NI GTS+   AV + CS   PC+ + + ++ + Y G     
Sbjct  313  ICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKT 372
Query  356  TSTCSNVKPTFSGKQVPAIKCA 377
             + C+N K T  G    A  CA
Sbjct  373  MAVCTNAKVTAKGVS-EANTCA 393

Sequence Alignment: 7. Allergen Name: Sor h 13.0101 Sequence ID: A0A077B155

 Score = 268.0 bits 1148,  Expect = 5e-73
 Identities = 163/361 45%, Positives = 238/361 65%, Gaps = 7/361 1%
Query  6    SGSV--FNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPC 61
            SGS    +++  GAKG G  D ++A+ +AW AAC  +GP T++IPKG+Y  G +   GPC
Sbjct  49   SGSAGGSDISKLGAKGDGKTDSTKALNEAWAAACGKEGPQTLMIPKGDYLTGPLNFSGPC 108
Query  62   KGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKN 121
            KGS +  Q+DG +    D S +K++ W+    +D L +SG GTLDGQG+  W  N C + 
Sbjct  109  KGS-VTIQLDGNLLGTTDLSAYKTN-WIEIEHVDNLVISGKGTLDGQGKQVWDNNKCAQK 166
Query  122  PNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGI 181
             +CK    +L +D++ +  V  IT LN+K FH+NV++C+ +T + VTVTAPG S NTDGI
Sbjct  167  YDCKILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGI 226
Query  182  HVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRG 241
            H+G S  VTIT T I  GDDCISIGPGS  + +T V CGPGHGIS+GSLGRY +EK+V  
Sbjct  227  HIGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTD 286
Query  242  ITVKGCTFSGTMNGVRVKTWPNSP-PGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSR 300
            I VK CT+  T NGVR+K++ ++     A+ L ++++ M++V NP+I+D +YCP   C+ 
Sbjct  287  INVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICTA 346
Query  301  QAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCS 360
            +  S++ + ++ F NI GTS+   AV + CS  +PCS + +  I + Y+G      + C 
Sbjct  347  KGDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVCQ 406
Query  361  NVKPTFSG 368
            N K + +G
Sbjct  407  NAKGSATG 414

Sequence Alignment: 8. Allergen Name: Ole e 14.0101 Sequence ID: W8PPL3

 Score = 248.2 bits 1061,  Expect = 4e-67
 Identities = 149/358 41%, Positives = 240/358 67%, Gaps = 12/358 3%
Query  8    SVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSK 65
            ++F+V  YGAK  G  D +QA +KAWKAAC S GP+ V+IPKG++  GEV  QGPC   K
Sbjct  14   TIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPK 73
Query  66   -IGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKNPNC 124
             I  +I G V A  D S + S  W+ +  IDGL ++G GT++G+G+++W       N   
Sbjct  74   PITIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKSSWQFAGA--NNEG 131
Query  125  KHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVG 184
                ++L F  +K++ + D+  ++S  FH  V + E+I    + ++APG S NTDG+H+ 
Sbjct  132  PLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHIS 191
Query  185  ISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITV 244
             S  V +T++ I TGDDC+SIG G+ ++ ++ + CGPGHGIS+GSLG+  +E +V+GI+V
Sbjct  192  CSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGISV 251
Query  245  KGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAP- 303
              CT++GT NG R+KT+  SP   A+D+ ++D+ + +V+NP+++DQ Y      S++ P 
Sbjct  252  INCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY-----DSKKKPE 306
Query  304  -SRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNV 362
             S++K+S ++F NI+GT+  ++ V + CS  +PC ++++ +I+L+  GA G   S C+N 
Sbjct  307  QSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLKSVCANA 366
Query  363  KPTFSGKQVP 372
            K  + GK +P
Sbjct  367  KFVLKGKPIP 376

Sequence Alignment: 9. Allergen Name: Cari p 1.0101 Sequence ID: C9EA45

 Score = 214.9 bits 915,  Expect = 6e-57
 Identities = 147/368 39%, Positives = 227/368 61%, Gaps = 17/368 4%
Query  1    RGVQSSGSVFNVNDYGAKGAG---DISQAVMKAWKAACASQGPSTVLIP-KGNYNMGEVA 56
            R  +    +FNV+D+GA+G G   D  Q   +AW+ AC+ +GP+  L+P +  Y +G + 
Sbjct  108  RSAKPRSVIFNVDDFGAEGDGIHDDTQQVFEEAWEKACSYKGPALFLVPERRTYLIGPIR 167
Query  57   MQGPCKGSK-IGFQIDGVVKAPADPSKFKSDG--WVSFYRIDGLTVSGTGTLDGQGQTAW 113
              GPCK +  I  QI G + A  + S ++ D   W+    +D L V G GT+ G GQ  W
Sbjct  168  FLGPCKSNLVIQVQISGTILASDNRSDYRKDPRHWIVIDSVDNLLVEGGGTIHGNGQI-W 226
Query  114  AKNNCDKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPG 173
             +N+C K P CK A   + F   K+ MVR++   +++  +++  +C ++T   +TVTAP 
Sbjct  227  WRNSC-KAP-CKEAP-TVTFYKCKNLMVRNVKVQDAQQMQVSFEKCSEVTASDLTVTAPE 283
Query  174  TSINTDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRY 233
             S NTDGIHV  ++ + ITNT I  GDDCISI  GS+NV I ++ CGPGHGI++ SLG  
Sbjct  284  KSPNTDGIHVTNTQNILITNTFIG-GDDCISIESGSHNVQIEELTCGPGHGINVDSLGDN 342
Query  234  NNEKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYC 293
            N++  V  +TV G  +SGT NGVR+KT+     G+A+++ FQ++ M NV+NP+I+DQ YC
Sbjct  343  NSKAFVSFVTVNGAKLSGTTNGVRIKTYQGGS-GSASNIKFQNVDMENVKNPIIIDQNYC 401
Query  294  PYGQ-CSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRG-A 351
               + C +Q  S +++ ++ + NI+G S   VA+   CS   PC  +K+  + L      
Sbjct  402  DQKKPCKKQQKSAVQVKDVLYQNIQGNSASDVAIDFDCSENYPCLGVKLQNVRLQRADRV 461
Query  352  GGPATSTCSNVKPTFSGKQVPAIKC 376
               A + C++V+ T +G   P  +C
Sbjct  462  DEEAKAICNHVELTETGVVFP--RC 484

Sequence Alignment: 10. Allergen Name: Cry j 2 Sequence ID: P43212

 Score = 210.8 bits 897,  Expect = 1e-55
 Identities = 136/362 37%, Positives = 216/362 59%, Gaps = 16/362 4%
Query  8    SVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGN--YNMGEVAMQGPCKG 63
            ++FNV  YGA G G  D ++A   AW+AAC  + PS +L+  GN  + +  +   GPC+ 
Sbjct  57   NIFNVEKYGAVGDGKHDCTEAFSTAWQAAC--KKPSAMLLVPGNKKFVVNNLFFNGPCQ- 113
Query  64   SKIGFQIDGVVKAPADPSKFKSDG-WVSFYRIDGLTVSGTGTLDGQGQTAWAKNNC---D 119
                F++DG++ A  +P+ +K++  W+ F ++ G+T+ G G +DGQG+  WA   C   +
Sbjct  114  PHFTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWA-GQCKWVN 172
Query  120  KNPNC--KHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSIN 177
                C  +     ++FDF    +++ +  +NS  FH+    CE +    +++TAP  S N
Sbjct  173  GREICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPN 232
Query  178  TDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEK 237
            TDGI +  SK   +    I TGDDC++IG GS N+ I  + CGPGHGISIGSLGR N+  
Sbjct  233  TDGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRA 292
Query  238  EVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQ 297
            EV  + V G  F  T NG+R+KTW     G A+ + ++++ M N +NP++++Q YC    
Sbjct  293  EVSYVHVNGAKFIDTQNGLRIKTWQGGS-GMASHIIYENVEMINSENPILINQFYCTSAS 351
Query  298  CSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATS 357
              +   S +++ ++ + NIRGTS    A+ + CS  MPC ++K+ +I+L    +G  A+ 
Sbjct  352  ACQNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLT-SGKIASC 410
Query  358  TCSNVKPTFSGKQVPAIK 375
               N    FSG  +PA K
Sbjct  411  LNDNANGYFSGHVIPACK 428

Sequence Alignment: 11. Allergen Name: Cry j 2 Sequence ID: BAA06172

 Score = 209.9 bits 893,  Expect = 2e-55
 Identities = 135/362 37%, Positives = 216/362 59%, Gaps = 16/362 4%
Query  8    SVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGN--YNMGEVAMQGPCKG 63
            ++FNV  YGA G G  D ++A   AW+AAC  + PS +L+  G+  + +  +   GPC+ 
Sbjct  57   NIFNVEKYGAVGDGKHDCTEAFSTAWQAAC--KNPSAMLLVPGSKKFVVNNLFFNGPCQ- 113
Query  64   SKIGFQIDGVVKAPADPSKFKSDG-WVSFYRIDGLTVSGTGTLDGQGQTAWAKNNC---D 119
                F++DG++ A  +P+ +K++  W+ F ++ G+T+ G G +DGQG+  WA   C   +
Sbjct  114  PHFTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWA-GQCKWVN 172
Query  120  KNPNC--KHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSIN 177
                C  +     ++FDF    +++ +  +NS  FH+    CE +    +++TAP  S N
Sbjct  173  GREICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPN 232
Query  178  TDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEK 237
            TDGI +  SK   +    I TGDDC++IG GS N+ I  + CGPGHGISIGSLGR N+  
Sbjct  233  TDGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRA 292
Query  238  EVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQ 297
            EV  + V G  F  T NG+R+KTW     G A+ + ++++ M N +NP++++Q YC    
Sbjct  293  EVSYVHVNGAKFIDTQNGLRIKTWQGGS-GMASHIIYENVEMINSENPILINQFYCTSAS 351
Query  298  CSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATS 357
              +   S +++ ++ + NIRGTS    A+ + CS  MPC ++K+ +I+L    +G  A+ 
Sbjct  352  ACQNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLT-SGKIASC 410
Query  358  TCSNVKPTFSGKQVPAIK 375
               N    FSG  +PA K
Sbjct  411  LNDNANGYFSGHVIPACK 428

Sequence Alignment: 12. Allergen Name: Cha o 2.0101 Sequence ID: Q7M1E7

 Score = 209.0 bits 889,  Expect = 4e-55
 Identities = 135/367 36%, Positives = 216/367 58%, Gaps = 14/367 3%
Query  4    QSSGSVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGN-YNMGEVAMQGP 60
            + + +VFNV  YGA G G  D ++A    W AAC  +  + +L+P    + +  +  +GP
Sbjct  53   HDAATVFNVEQYGAVGDGKHDSTEAFATTWNAAC-KKASAVLLVPANKKFFVNNLVFRGP 111
Query  61   CKGSKIGFQIDGVVKAPADPSKFK-SDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNC- 118
            C+   + F++DG + A  DP+++K S  W+ F ++  + + GTG +DGQGQ  WA   C 
Sbjct  112  CQ-PHLSFKVDGTIVAQPDPARWKNSKIWLQFAQLTDFNLMGTGVIDGQGQQWWA-GQCK 169
Query  119  --DKNPNC--KHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGT 174
              +    C  ++    ++ D+ K   V+++T +NS  FH+   ECE +  Q + + AP  
Sbjct  170  VVNGRTVCNDRNRPTAIKIDYSKSVTVKELTLMNSPEFHLVFGECEGVKIQGLKIKAPRD 229
Query  175  SINTDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYN 234
            S NTDGI +  SK   I    I TGDDCI+IG GS N+TI  + CGPGHGISIGSLGR N
Sbjct  230  SPNTDGIDIFASKRFHIEKCVIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRDN 289
Query  235  NEKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCP 294
            +  EV  + V    F  T NG+R+KTW     G A+ +T++++ M N +NP++++Q YC 
Sbjct  290  SRAEVSHVHVNRAKFIDTQNGLRIKTWQGGS-GLASYITYENVEMINSENPILINQFYCT 348
Query  295  YGQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGP 354
                 +   S +++  + + NI GTS    A+ + CS  +PC+ +++  ++L    +G P
Sbjct  349  SASACQNQRSAVQIQGVTYKNIHGTSATAAAIQLMCSDSVPCTGIQLSNVSLKLT-SGKP 407
Query  355  ATSTCSNVKPTFSGKQVPAIK 375
            A+    N +  +SG+ +P  K
Sbjct  408  ASCVDKNARGFYSGRLIPTCK 428

Sequence Alignment: 13. Allergen Name: Jun a 2 Sequence ID: CAC05582

 Score = 205.3 bits 873,  Expect = 5e-54
 Identities = 138/361 38%, Positives = 208/361 57%, Gaps = 16/361 4%
Query  9    VFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGN-YNMGEVAMQGPCKGSK 65
            VFNV  YGA G G  D + A  K W AAC ++  +  L+P    + +  +   GPC+   
Sbjct  59   VFNVEHYGAVGDGKHDSTDAFEKTWNAAC-NKLSAVFLVPANKKFVVNNLVFYGPCQ-PH 116
Query  66   IGFQIDGVVKAPADPSKFK-SDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKNPN- 123
              F++DG + A  DP+K+K S  W+ F R+  + + GTG +DGQG   W+ + C K  N 
Sbjct  117  FSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFNLMGTGVIDGQGNRWWS-DQC-KTING 174
Query  124  ---C--KHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINT 178
               C  K     ++ DF K   V+++T  NS  FH+   EC+ +  Q + + AP  S NT
Sbjct  175  RTVCNDKGRPTAIKIDFSKSVTVKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNT 234
Query  179  DGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKE 238
            DGI +  SK   I    I TGDDC+++G GS N+TI  + CGPGHG+SIGSLG+ N+  E
Sbjct  235  DGIDIFASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSE 294
Query  239  VRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQC 298
            V  + + G  F  T NG+R+KTW     G A+ +T++++ M N +NP++++Q YC     
Sbjct  295  VSFVHLDGAKFIDTQNGLRIKTWQGGS-GLASHITYENVEMINAENPILINQFYCTSAAA 353
Query  299  SRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATST 358
             +   S +K+ ++ F NI GTS    A+ + CS  +PCSN+K+  + L    +G  AT  
Sbjct  354  CKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVFLKLT-SGKVATCV 412
Query  359  CSNVKPTFSGKQVPAIK 375
              N    ++    P+ K
Sbjct  413  NKNANGYYTNPLNPSCK 429

Sequence Alignment: 14. Allergen Name: Cup s 2.0101 Sequence ID: C0HKB1

 Score = 41.0 bits 150,  Expect = 5e-05
 Identities = 21/41 51%, Positives = 28/41 68%, Gaps = 0/41 0%
Query  217  VNCGPGHGISIGSLGRYNNEKEVRGITVKGCTFSGTMNGVR 257
            + CGPGHG+SIGSLG+ N+  EV  + + G  F  T NG+R
Sbjct  98   LTCGPGHGMSIGSLGKGNSRSEVSFVHLDGAKFIDTQNGLR 138

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.