The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP
FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS
HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE
QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF
SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN
LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE
GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR
EQARQLKNNNPFKFFVPPSQQSPRAVA
Sequence Info Allergen Name Length Opt Bits Score E Value
O82580 Ara h 3 507 3438 789.9 0
AAC63045 Ara h 3 510 3438 789.9 0
AAD47382 Ara h 4 530 3112 715.6 1.7e-207
P11828 Gly m 6.0301 481 1113 260.0 2.2e-70
AAA33966 Gly m glycinin G1 495 1102 257.4 1.3e-69
P04776 Gly m 6.0101 495 1102 257.4 1.3e-69
Q7GC77 Gly m 6.0501 517 1093 255.4 5.6e-69
CAA68460 Gly m glycinin G2 485 1083 253.1 2.5e-68
P04405 Gly m 6.0201 485 1083 253.1 2.5e-68
AAL73404 Cor a 9 515 839 197.5 1.5e-51
ADN39440 Pru du 6.0101 551 827 194.7 1.1e-50
3EHK_A Pru du 6 531 822 193.6 2.3e-50
ABW86978 Car i 4.0101 505 821 193.4 2.5e-50
A0A1L6K371 Jug n 4.0101 510 804 189.5 3.8e-49
Q2TPW5 Jug r 4.0101 507 784 185.0 8.8e-48
ADN39441 Pru du 6.0201 504 708 167.6 1.4e-42
P09800 Gos h 4 516 667 158.3 9.6e-40
AAN76862 Ana o 2 457 665 157.9 1.1e-39
EU410073 Pis v 5.0101 473 632 150.3 2.2e-37
P09802 Gos h 3 509 625 148.7 7.2e-37
DQ631676 Pis v 2.0101 496 578 138.0 1.2e-33
P13744 Cuc ma 4.0101 480 551 131.9 8e-32
BAA21758 Fag e 1 565 548 131.1 1.6e-31
DQ631677 Pis v 2.0201 472 539 129.1 5.2e-31
Q9XFM4 Fag e 1 538 538 128.9 7.1e-31
Q9AUD2 Ses i 7.0101 497 533 127.7 1.4e-30
QYU76046 Zan b 2.0102 388 531 127.4 1.5e-30
QYU76045 Zan b 2.0101 389 531 127.4 1.5e-30
BAA21760 Fag e 1 504 523 125.5 7.1e-30
QYS16039 Zan b 2.03 389 517 124.2 1.3e-29
Q9SB11 Gly m 6.0401 563 519 124.5 1.5e-29
AAO38859 Ber e 2 465 482 116.1 4.2e-27
QYU76044 Zan b 2.02 383 471 113.7 1.9e-26
Q2TLW0 Sin a 2.0101 510 458 110.6 2.1e-25
Q9XHP0 Ses i 6.0101 459 456 110.2 2.5e-25
A0A0S3B0K0 Coc n 1.0101 490 174 45.9 6.1e-06
AAM54366 Jug n 2 481 160 42.7 5.4e-05
B3STU4 Car i 2.0101 792 160 42.6 9.5e-05
AAF18269 Jug r 2 593 156 41.8 0.00013
O22120 Gly m 5.0101 543 155 41.6 0.00014
CAA35691 Gly m conglycinin 605 153 41.1 0.00021
AAB01374 Gly m conglycinin 639 130 35.8 0.0086
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 789.9 bits 3438,  Expect = 0
 Identities = 507/507 100%, Positives = 507/507 100%, Gaps = 0/507 0%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP
Sbjct  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
            FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS
Sbjct  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE
Sbjct  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF
Sbjct  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
Sbjct  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
Query  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
            EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN
Sbjct  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
Query  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
            LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE
Sbjct  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
Query  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
            GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR
Sbjct  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
Query  481  EQARQLKNNNPFKFFVPPSQQSPRAVA 507
            EQARQLKNNNPFKFFVPPSQQSPRAVA
Sbjct  481  EQARQLKNNNPFKFFVPPSQQSPRAVA 507

Sequence Alignment: 2. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 789.9 bits 3438,  Expect = 0
 Identities = 507/507 100%, Positives = 507/507 100%, Gaps = 0/507 0%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP
Sbjct  4    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 63
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
            FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS
Sbjct  64   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 123
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE
Sbjct  124  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 183
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF
Sbjct  184  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 243
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
Sbjct  244  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 303
Query  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
            EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN
Sbjct  304  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 363
Query  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
            LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE
Sbjct  364  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 423
Query  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
            GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR
Sbjct  424  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 483
Query  481  EQARQLKNNNPFKFFVPPSQQSPRAVA 507
            EQARQLKNNNPFKFFVPPSQQSPRAVA
Sbjct  484  EQARQLKNNNPFKFFVPPSQQSPRAVA 510

Sequence Alignment: 3. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 715.6 bits 3112,  Expect = 2e-207
 Identities = 463/507 91%, Positives = 475/507 93%, Gaps = 0/507 0%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP
Sbjct  24   RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 83
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
            FYSNAPQEIFIQQGRGYFGLIFPGCP  YEEP  QGRR QSQRPPRRLQ EDQSQQQ+DS
Sbjct  84   FYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDS 143
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQKVHRF+EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN E
Sbjct  144  HQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHE 203
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QEFLRYQQQSRQSRRRSLPYSPYSP+S+PR+EEREF PRGQHSRRERAGQEEE+EGGNIF
Sbjct  204  QEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIF 263
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            SGFTPEFLEQAFQVDDRQIVQNL GE ESEEEGAIVTVRGGLRILSPD  R ADEEEEYD
Sbjct  264  SGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYD 323
Query  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
            ED+YEY E+D RRGRGSRG GNGIEETICTA  KKNIG NRSP IY+PQ    +  +DLN
Sbjct  324  EDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLN 383
Query  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
            LLILRWLG SAEYGNLYRNALFV HYNTNAHSIIY LRGRAHVQVVDSNGNRVYDEELQE
Sbjct  384  LLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQE 443
Query  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
            GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN+AGENS IDNLPEEVVANSYGL R
Sbjct  444  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPR 503
Query  481  EQARQLKNNNPFKFFVPPSQQSPRAVA 507
            EQARQLKNNNPFKFFVPP QQSPRAVA
Sbjct  504  EQARQLKNNNPFKFFVPPFQQSPRAVA 530

Sequence Alignment: 4. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 260.0 bits 1113,  Expect = 2e-70
 Identities = 295/459 64%, Positives = 369/459 80%, Gaps = 48/459 10%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            R+QP++N CQ QRLNA +PDNRIESEGG+IETWNPNN+ F+CAGVALSR  L RNALRRP
Sbjct  23   REQPQQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRP 82
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             Y+NAPQEI+IQQG G FG+IFPGCP  +EEP+ +G   QS RP             +D 
Sbjct  83   SYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQKG---QSSRP-------------QDR 126
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQK++ F EGDLIAVPTG A+W+YN+ DT VVAVSL DTN+  NQLDQ PRRF LAGN E
Sbjct  127  HQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQE 186
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QEFL+YQ Q +Q                           G +S++ +  QEEENEGG+I+
Sbjct  187  QEFLQYQPQKQQG--------------------------GTQSQKGKRQQEEENEGGSIL 220
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            SGF PEFLE+AF VD RQIV+ L+GE E EE+GAIVTV+GGL ++SP  + +    EE  
Sbjct  221  SGFAPEFLEHAFVVD-RQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEE-- 277
Query  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
            E++ + DE+D+     SR   NGI+ETICT   + NIG+  SPDI+NPQAGS+ TA  L+
Sbjct  278  EEKPDCDEKDKHCQSQSR---NGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLD 334
Query  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
            +  L WL  SA++G+L +NA+FV HYN NA+SIIY L GRA VQVV+ NG RV+D ELQE
Sbjct  335  FPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQE 394
Query  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
            G+VL+VPQNFAVA +SQS+NFEYV+FKT+ RPSI NLAG NS+++ LPEEV+  ++ L+R
Sbjct  395  GQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRR 454
Query  481  EQARQLKNNNPFKFFVPPSQQSPRAVA 507
            +QARQ+KNNNPF F+VPP +   R VA
Sbjct  455  QQARQVKNNNPFSFLVPPKESQRRVVA 481

Sequence Alignment: 5. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 257.4 bits 1102,  Expect = 1e-69
 Identities = 296/465 63%, Positives = 374/465 80%, Gaps = 50/465 10%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            R+QP++N CQ Q+LNA +PDNRIESEGG IETWNPNN+ F+CAGVALSR  L RNALRRP
Sbjct  23   REQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRP 82
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             Y+N PQEI+IQQG+G FG+I+PGCP  +EEP+   +R QS RP             +D 
Sbjct  83   SYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDR 129
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQK++ F EGDLIAVPTGVA+W+YN+ DT VVAVS+ DTN+ +NQLDQ PRRF LAGN E
Sbjct  130  HQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQE 189
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QEFL+YQQ+  Q             QSQ          +G+H       QEEENEGG+I+
Sbjct  190  QEFLKYQQE--QG----------GHQSQ----------KGKHQ------QEEENEGGSIL 221
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSP---DRKRRADEEE 297
            SGFT EFLE+AF VD +QI +NL+GE E E++GAIVTV+GGL ++ P   ++++R  EEE
Sbjct  222  SGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE 280
Query  298  EYDEDEYEY----DEEDRR-RGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGS 352
            E +EDE       D+  +R RG  S+ R NGI+ETICT   + NIG+  SPDIYNPQAGS
Sbjct  281  EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGS 340
Query  353  LKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNR 412
            + TA  L++  L WL  SAE+G+L +NA+FV HYN NA+SIIY L GRA +QVV+ NG R
Sbjct  341  VTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER 400
Query  413  VYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVV 472
            V+D ELQEG VL+VPQNF VA +SQS+NFEYV+FKT+  P I  LAG NS+++ LPEEV+
Sbjct  401  VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVI 460
Query  473  ANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA 507
             +++ L+ +QARQ+KNNNPFKF+VPP +   RAVA
Sbjct  461  QHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA 495

Sequence Alignment: 6. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 257.4 bits 1102,  Expect = 1e-69
 Identities = 296/465 63%, Positives = 374/465 80%, Gaps = 50/465 10%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            R+QP++N CQ Q+LNA +PDNRIESEGG IETWNPNN+ F+CAGVALSR  L RNALRRP
Sbjct  23   REQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRP 82
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             Y+N PQEI+IQQG+G FG+I+PGCP  +EEP+   +R QS RP             +D 
Sbjct  83   SYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDR 129
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQK++ F EGDLIAVPTGVA+W+YN+ DT VVAVS+ DTN+ +NQLDQ PRRF LAGN E
Sbjct  130  HQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQE 189
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QEFL+YQQ+  Q             QSQ          +G+H       QEEENEGG+I+
Sbjct  190  QEFLKYQQE--QG----------GHQSQ----------KGKHQ------QEEENEGGSIL 221
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSP---DRKRRADEEE 297
            SGFT EFLE+AF VD +QI +NL+GE E E++GAIVTV+GGL ++ P   ++++R  EEE
Sbjct  222  SGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE 280
Query  298  EYDEDEYEY----DEEDRR-RGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGS 352
            E +EDE       D+  +R RG  S+ R NGI+ETICT   + NIG+  SPDIYNPQAGS
Sbjct  281  EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGS 340
Query  353  LKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNR 412
            + TA  L++  L WL  SAE+G+L +NA+FV HYN NA+SIIY L GRA +QVV+ NG R
Sbjct  341  VTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER 400
Query  413  VYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVV 472
            V+D ELQEG VL+VPQNF VA +SQS+NFEYV+FKT+  P I  LAG NS+++ LPEEV+
Sbjct  401  VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVI 460
Query  473  ANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA 507
             +++ L+ +QARQ+KNNNPFKF+VPP +   RAVA
Sbjct  461  QHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA 495

Sequence Alignment: 7. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 255.4 bits 1093,  Expect = 6e-69
 Identities = 216/445 48%, Positives = 297/445 66%, Gaps = 80/445 17%
Query  7    NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAP 66
            N CQ+  LNA  PD+R+ESEGG IETWN  + E++CAGV +S+  L RN L  P YS  P
Sbjct  31   NECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYP 90
Query  67   QEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHR 126
            Q I + QG+G  G+ FPGCP  +E+P+ Q  R          +G    QQ +DSHQK+  
Sbjct  91   QMIIVVQGKGAIGFAFPGCPETFEKPQQQSSR----------RGSRSQQQLQDSHQKIRH 140
Query  127  FDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRY 186
            F+EGD++ +P GV +W YN  D  VVA+SL DT+N +NQLDQ PR F LAGN + E    
Sbjct  141  FNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEH--- 197
Query  187  QQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPE 246
                           P + Q Q +Q+      +GQH       Q++E EGG+++SGF+  
Sbjct  198  ---------------PETMQQQQQQKSHGGRKQGQH-------QQQEEEGGSVLSGFSKH 235
Query  247  FLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDE----- 301
            FL Q+F  ++    + LR  +  +E   IVTV GGL ++SP  + + DE+E+ DE     
Sbjct  236  FLAQSFNTNE-DTAEKLR--SPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQT 292
Query  302  ---------------DEYEYDEEDRRRG-----RGSR-------GRG----NGIEETICT 330
                           DE E +EED+ R      R SR       GRG    NG+EE ICT
Sbjct  293  PSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICT 352
Query  331  ASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNA 390
                +NI R    D YNP+AG + T N L L  LR +G SA+Y  LYRN ++  H+N NA
Sbjct  353  MKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNA 412
Query  391  HSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS 450
            +S+IY  RG+  V+VV+  GN V+D EL+ G++LVVPQNF VA +   + +EYV FKT  
Sbjct  413  NSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHH 472
Query  451  RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLK---NNNPF 492
              ++++      V   +P EV++NSY L + Q RQLK   N+ P+
Sbjct  473  N-AVSSYI--KDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPL 514

Sequence Alignment: 8. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 253.1 bits 1083,  Expect = 3e-68
 Identities = 297/465 63%, Positives = 372/465 80%, Gaps = 43/465 9%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            R+Q ++N CQ Q+LNA +PDNRIESEGG+IETWNPNN+ F+CAGVALSR  L RNALRRP
Sbjct  20   REQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRP 79
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             Y+N PQEI+IQQG G FG+IFPGCP  Y+EP+   +R +SQRP             +D 
Sbjct  80   SYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRP-------------QDR 126
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQKVHRF EGDLIAVPTGVA+W+YN+ DT VVAVS+ DTN+ +NQLDQ PRRF LAGN E
Sbjct  127  HQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQE 186
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QEFL+YQQQ +              QSQ          +G++       QEEENEG NI+
Sbjct  187  QEFLKYQQQQQGGS-----------QSQ----------KGKQ-------QEEENEGSNIL 218
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            SGF PEFL++AF V+  QIV+NL+GE E E+ GAIVTV+GGLR+ +P  ++   EE++ D
Sbjct  219  SGFAPEFLKEAFGVN-MQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDD 277
Query  301  EDEY-EYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDL 359
            E+E  +  E D+   R S+   NGI+ETICT   ++NIG+N SPDIYNPQAGS+ TA  L
Sbjct  278  EEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSL 337
Query  360  NLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQ 419
            ++  L  L  SA+YG+L +NA+FV HY  NA+SIIY L GRA VQVV+ NG RV+D ELQ
Sbjct  338  DFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQ 397
Query  420  EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQ 479
            EG VL+VPQNFAVA KSQS+NFEYV+FKT+ RPSI NLAG NS+++ LPEEV+ +++ L+
Sbjct  398  EGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLK 457
Query  480  REQARQLKNNNPFKFFVPPSQQSPRAVA 507
             +QARQ+KNNNPF F+VPP +   RAVA
Sbjct  458  SQQARQVKNNNPFSFLVPPQESQRRAVA 485

Sequence Alignment: 9. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 253.1 bits 1083,  Expect = 3e-68
 Identities = 297/465 63%, Positives = 372/465 80%, Gaps = 43/465 9%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            R+Q ++N CQ Q+LNA +PDNRIESEGG+IETWNPNN+ F+CAGVALSR  L RNALRRP
Sbjct  20   REQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRP 79
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             Y+N PQEI+IQQG G FG+IFPGCP  Y+EP+   +R +SQRP             +D 
Sbjct  80   SYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRP-------------QDR 126
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQKVHRF EGDLIAVPTGVA+W+YN+ DT VVAVS+ DTN+ +NQLDQ PRRF LAGN E
Sbjct  127  HQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQE 186
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QEFL+YQQQ +              QSQ          +G++       QEEENEG NI+
Sbjct  187  QEFLKYQQQQQGGS-----------QSQ----------KGKQ-------QEEENEGSNIL 218
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            SGF PEFL++AF V+  QIV+NL+GE E E+ GAIVTV+GGLR+ +P  ++   EE++ D
Sbjct  219  SGFAPEFLKEAFGVN-MQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDD 277
Query  301  EDEY-EYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDL 359
            E+E  +  E D+   R S+   NGI+ETICT   ++NIG+N SPDIYNPQAGS+ TA  L
Sbjct  278  EEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSL 337
Query  360  NLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQ 419
            ++  L  L  SA+YG+L +NA+FV HY  NA+SIIY L GRA VQVV+ NG RV+D ELQ
Sbjct  338  DFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQ 397
Query  420  EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQ 479
            EG VL+VPQNFAVA KSQS+NFEYV+FKT+ RPSI NLAG NS+++ LPEEV+ +++ L+
Sbjct  398  EGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLK 457
Query  480  REQARQLKNNNPFKFFVPPSQQSPRAVA 507
             +QARQ+KNNNPF F+VPP +   RAVA
Sbjct  458  SQQARQVKNNNPFSFLVPPQESQRRAVA 485

Sequence Alignment: 10. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 197.5 bits 839,  Expect = 2e-51
 Identities = 233/469 49%, Positives = 315/469 67%, Gaps = 35/469 7%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            +QQ     C + RLNA  P NRIE+E   IE+W+ N+Q+F+CAGVA+ R  +  N L  P
Sbjct  30   QQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLP 89
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQ-QRD 119
             YSNAP+ I+I++GRG  G++FPGCP  +E+P+ Q +  Q QR     QG+ QSQ+ ++D
Sbjct  90   QYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQ--QGQR-----QGQGQSQRSEQD 142
Query  120  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 179
             HQK+  F EGD+IA+P GVA W YND D+ VV VSL  TNN  NQLD+ PR F LAGN 
Sbjct  143  RHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNP 202
Query  180  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 239
            + E  R  QQ    RRR                      + QHS  E+  QE++ EG N+
Sbjct  203  DDEHQRQGQQQFGQRRR----------------------QQQHSHGEQGEQEQQGEGNNV 240
Query  240  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEY 299
            FSGF  EFL  AF VD   +    R ++  ++   IV V G L+++ P+R R+  E +E 
Sbjct  241  FSGFDAEFLADAFNVD---VDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQER 297
Query  300  DEDEYEYDEEDRRRGRGSRGRG-NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND 358
             E E E + E +RR +G RGR  NG EETIC+   ++NI      DIY  Q G + T N 
Sbjct  298  QERESEQERERQRR-QGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNS 356
Query  359  LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEEL 418
              L +LRWL  SAE G+L R  L+V H+N NAHS++Y +RGRA VQVVD NGN V+D+EL
Sbjct  357  NTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDEL 416
Query  419  QEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL 478
            ++G+VL +PQNFAVA +++SE FE+VAFKT+    I+ LAG  S I  LP++V+AN++ +
Sbjct  417  RQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQI 476
Query  479  QREQARQLKNNNPFKFFVPPSQQS 502
             RE+AR+LK N     +V  S+ S
Sbjct  477  SREEARRLKYNRQETTLVRSSRSS 500

Sequence Alignment: 11. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 194.7 bits 827,  Expect = 1e-50
 Identities = 231/477 48%, Positives = 331/477 69%, Gaps = 77/477 16%
Query  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
            Q   +N CQ+ +L A+ PDNRI++E G IETWN N ++F+CAGVA SR+ ++RN L  P 
Sbjct  25   QLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQEDFQCAGVAASRITIQRNGLHLPS 84
Query  62   YSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHT---QGR-------RSQSQRPPR-RLQG 110
            YSNAPQ I+I QGRG +G +F GCP  +EE +    QGR       R Q Q+  + R QG
Sbjct  85   YSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQG 144
Query  111  EDQSQQQR-----------------------------------DSHQKVHRFDEGDLIAV 135
            + + QQ+R                                   D HQK  R  EGD++A+
Sbjct  145  QQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIREGDVVAI 204
Query  136  PTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRR 195
            P GVA+W YND D ++VAV+L   +++ NQLDQ PR+F LAGN E EF    QQ      
Sbjct  205  PAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEF---NQQG----- 256
Query  196  RSLPYSPYSPQSQPRQEEREFSPRGQHSR---RERAGQEEENEGGNIFSGFTPEFLEQAF 252
                      QSQPRQ+  +  P GQH +   R R  QE++  G N+FSGF  ++L QA+
Sbjct  257  ----------QSQPRQQGEQGRP-GQHQQPFGRPRQ-QEQQGSGNNVFSGFNTQLLAQAL 304
Query  253  QVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRR 312
             V++ +  +NL+G+ ++  +  I+ VRG L  + P R R   +E E++E + E  +++R+
Sbjct  305  NVNE-ETARNLQGQNDNRNQ--IIRVRGNLDFVQPPRGR---QEREHEERQQEQLQQERQ 358
Query  313  RGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAE 372
            + +G +   NG+EET C+   K+NIG     DI++P+AG + T N  NL ILR+L  SAE
Sbjct  359  Q-QGGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAE 417
Query  373  YGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAV 432
             G +YRN ++  H+N NAHS++Y +RG A VQVV+ NG+ + D+E+Q+G++++VPQN  V
Sbjct  418  RGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGV 477
Query  433  AGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPF 492
              ++ ++ FEY AFKT+    I  LAG  S +  LP+EV+AN+Y + REQARQLK N   
Sbjct  478  IQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQE 537
Query  493  KFFVPPSQQSPRAV 506
               +  SQQ  RAV
Sbjct  538  TIALSSSQQR-RAV 550

Sequence Alignment: 12. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 193.6 bits 822,  Expect = 2e-50
 Identities = 231/477 48%, Positives = 330/477 69%, Gaps = 77/477 16%
Query  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
            Q   +N CQ+ +L A+ PDNRI++E G IETWN N  +F+CAGVA SR+ ++RN L  P 
Sbjct  5    QLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPS 64
Query  62   YSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHT---QGR-------RSQSQRPPR-RLQG 110
            YSNAPQ I+I QGRG +G +F GCP  +EE +    QGR       R Q Q+  + R QG
Sbjct  65   YSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQG 124
Query  111  EDQSQQQR-----------------------------------DSHQKVHRFDEGDLIAV 135
            + + QQ+R                                   D HQK  R  EGD++A+
Sbjct  125  QQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAI 184
Query  136  PTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRR 195
            P GVA+W YND D ++VAV+L   +++ NQLDQ PR+F LAGN E EF    QQ      
Sbjct  185  PAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEF---NQQG----- 236
Query  196  RSLPYSPYSPQSQPRQEEREFSPRGQHSR---RERAGQEEENEGGNIFSGFTPEFLEQAF 252
                      QSQPRQ+  +  P GQH +   R R  QE++  G N+FSGF  ++L QA+
Sbjct  237  ----------QSQPRQQGEQGRP-GQHQQPFGRPRQ-QEQQGNGNNVFSGFNTQLLAQAL 284
Query  253  QVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRR 312
             V++ +  +NL+G+ ++  +  I+ VRG L  + P R R   +E E++E + E  +++R+
Sbjct  285  NVNE-ETARNLQGQNDNRNQ--IIQVRGNLDFVQPPRGR---QEREHEERQQEQLQQERQ 338
Query  313  RGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAE 372
            + +G +   NG+EET C+   K+NIG     DI++P+AG + T N  NL ILR+L  SAE
Sbjct  339  Q-QGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAE 397
Query  373  YGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAV 432
             G +YRN ++  H+N NAHS++Y +RG A VQVV+ NG+ + D+E+Q+G++++VPQN  V
Sbjct  398  RGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGV 457
Query  433  AGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPF 492
              ++ ++ FEY AFKT+    I  LAG  S +  LP+EV+AN+Y + REQARQLK N   
Sbjct  458  IQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQE 517
Query  493  KFFVPPSQQSPRAV 506
               +  SQQ  RAV
Sbjct  518  TIALSSSQQR-RAV 530

Sequence Alignment: 13. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 193.4 bits 821,  Expect = 3e-50
 Identities = 233/469 49%, Positives = 311/469 66%, Gaps = 38/469 8%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            RQQ +   CQ+ RL+A  P NRIE+E G IE+W+PN+Q+++CAGVA+ R  +  N L  P
Sbjct  29   RQQHKFGQCQLNRLDALEPTNRIEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLP 88
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             YSNAPQ ++I +GRG  G++FPGCP  +EE + Q     SQ+  RR       + Q+D 
Sbjct  89   HYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQ-----SQQGQRR-------EFQQDR 136
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQK+  F EGD+IA P GVA W YND  + VVA+ L DT+NN NQLDQ PR F LAGN +
Sbjct  137  HQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRNFYLAGNPD 196
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
             EF    QQ  +  RR         Q Q +Q       RG+H      G+++ + G N+F
Sbjct  197  DEFRPQGQQEYEQHRR---------QQQHQQR------RGEH------GEQQRDLGNNVF 235
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRG-GLRILSPDRKRRADEEEEY 299
            SGF  EFL  AF VD        R ++E++  G+IV V G  L+++ P   R   E EE 
Sbjct  236  SGFDAEFLADAFNVDTETAR---RLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEER 292
Query  300  DEDEYEYDEEDRRRGRGSRGRG-NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND 358
             E E E + E  RR     GR  NG+EETICT S ++NIG     DIY  +AG + T N 
Sbjct  293  KERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNS 352
Query  359  LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEEL 418
             NL ILRWL  SAE G LY +AL+V H+N NAHS++Y LRGRA VQVVD+ G  V+D+EL
Sbjct  353  HNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDEL 412
Query  419  QEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL 478
            +EG++L +PQNFAV  +++ E FE+V+FKT+    ++ LAG  S I  LPEEV+ N++ +
Sbjct  413  REGQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQI 472
Query  479  QREQARQLKNNNPFKFFVPPSQQSPRA 505
             RE AR+LK N     +V    +S R+
Sbjct  473  PREDARRLKFNRQESTLVRSRSRSSRS 499

Sequence Alignment: 14. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 189.5 bits 804,  Expect = 4e-49
 Identities = 238/472 50%, Positives = 313/472 66%, Gaps = 39/472 8%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            RQQP    C+++RL A  P NRIE+E G IE+W+PNNQ+F+CAGVA+ R  +  N L  P
Sbjct  27   RQQPRFGECKLKRLVALEPSNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLP 86
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQ-RPPRRLQGEDQSQQQRD 119
             YSNAPQ ++I +GRG  G++FPGCP  +EE + QG   QS+ RP  R      +  QRD
Sbjct  87   QYSNAPQLLYIVKGRGITGVLFPGCPETFEESQ-QG---QSRIRPSLR-----SASFQRD 137
Query  120  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 179
             HQK+  F EGD+IA P GVA W YND DT VVAV+L DT NN NQLDQ PR F LAGN 
Sbjct  138  RHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNNANQLDQNPRNFYLAGNP 197
Query  180  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 239
            + EF    QQ  +  RR           Q ++++R   P          GQ++   G N+
Sbjct  198  DDEFRPQGQQEYEQHRR-----------QQQHQQRHGEP----------GQQQRGSGNNV 236
Query  240  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRG-GLRILSPDRKRRADEEEE 298
            FSGF  +FL  AF VD        R ++E++   +IV V G  L+++ P   R   E EE
Sbjct  237  FSGFDADFLADAFNVDTETAR---RLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREE 293
Query  299  YDEDEYEYDEEDRRRGRGSRGRG-NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAN 357
              E E E + E  RR     GR  NG+EETICT   ++NIG     DIY  +AG + TAN
Sbjct  294  RKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTAN 353
Query  358  DLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEE 417
               L +LRWL  SAE G LY +AL+V H+N NAHS++Y LRGRA VQVVD+ G  V+D+E
Sbjct  354  SHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDE 413
Query  418  LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYG 477
            L+EG++L +PQNFAV  ++++E FE+V+FKT+    ++ LAG  S I  LPEEV+AN+  
Sbjct  414  LREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANALQ 473
Query  478  LQREQARQLKNNNPFKFFV---PPSQQSPRA 505
            + RE AR+LK N     +V   P S +S R+
Sbjct  474  IPREDARRLKFNRQESTLVRSRPSSSRSSRS 504

Sequence Alignment: 15. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 185.0 bits 784,  Expect = 9e-48
 Identities = 232/469 49%, Positives = 311/469 66%, Gaps = 41/469 8%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            RQQ +   CQ+ RL+A  P NRIE+E G IE+W+PNNQ+F+CAGVA+ R  +  N L  P
Sbjct  28   RQQQQFGQCQLNRLDALEPTNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLP 87
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             YSNAPQ ++I +GRG  G++FPGCP  +EE + Q ++ QS+            + Q+D 
Sbjct  88   QYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQSQQGQSR------------EFQQDR 135
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQK+  F EGD+IA P GVA W YND    VVA+SL DTNNN NQLDQ PR F LAGN +
Sbjct  136  HQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNFYLAGNPD 195
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
             EF R Q Q    + R             RQ++R+  P G+H      GQ++   G N+F
Sbjct  196  DEF-RPQGQQEYEQHR-------------RQQQRQQRP-GEH------GQQQRGLGNNVF 234
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRG-GLRILSPDRKRRADEEEEY 299
            SGF  +FL  AF VD        R ++E++   +IV V G  L+++ P   R   E EE 
Sbjct  235  SGFDADFLADAFNVDTETAR---RLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREER 291
Query  300  DEDEYEYDEEDRRRGRGSRGRG-NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND 358
             E E E + E  RR     GR  NG+EETICT   ++NIG     DIY  +AG + T N 
Sbjct  292  KERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNS 351
Query  359  LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEEL 418
              L +LRWL  SAE G LY +AL+V H+N NAHS++Y LRGRA VQVVD+ G  V+D+EL
Sbjct  352  HTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDEL 411
Query  419  QEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL 478
            +EG++L +PQNFAV  ++++E FE+V+FKT+    ++ LAG  S I  LPEEV+A ++ +
Sbjct  412  REGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQI 471
Query  479  QREQARQLKNNNPFKFFV---PPSQQSPRA 505
             RE AR+LK N     +V   P   +S R+
Sbjct  472  PREDARRLKFNRQESTLVRSRPSRSRSSRS 501

Sequence Alignment: 16. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 167.6 bits 708,  Expect = 1e-42
 Identities = 201/444 45%, Positives = 303/444 68%, Gaps = 50/444 11%
Query  10   QFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEI 69
            Q+ +L A+ PDN I+SE G  E+WNP++ +F+ AGVA+ R  +  N L  P Y NAPQ I
Sbjct  24   QLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLI 83
Query  70   FIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQ----RPPRRLQGEDQSQ----QQRDSH 121
            +I +GRG +G +FPGC   +E+ + Q  + Q Q    RP R+  G+ Q Q     Q+D H
Sbjct  84   YIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRH 143
Query  122  QKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ 181
            QK+    EGD+IA+P GVA+W YN+ +  +VAVSL D NN+ NQLDQ PRRF LAGN + 
Sbjct  144  QKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQD 203
Query  182  EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFS 241
            EF                    +PQ Q RQ++++   +GQ           +  G NIFS
Sbjct  204  EF--------------------NPQQQGRQQQQQ--QQGQ-----------QGNGNNIFS 230
Query  242  GFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKR---RADEEEE 298
            GF  ++L QA+ V+  +  +NL+G+ ++  E  IV V+G L  +SP  +    R D+E +
Sbjct  231  GFDTQLLAQALNVNP-ETARNLQGQDDNRNE--IVRVQGQLDFVSPFSRSAGGRGDQERQ 287
Query  299  YDEDEYEYDEEDRRR---GRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKT 355
             +E + + + E+++R    +G  G+ NG+EET C+A   +NIG     D YNPQ G +  
Sbjct  288  QEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISV 347
Query  356  ANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYD 415
             N  +L ILR+L  SAE G LY NA++  H++TNA++++Y +RG A VQVV+ NG+ + D
Sbjct  348  VNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILD 407
Query  416  EELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANS 475
            +E++EG+++++PQN AV  ++ +E FEY++F+TD       LAG  SV+  LP+EV+ N+
Sbjct  408  DEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNA 467
Query  476  YGLQREQARQLKNN 489
            + + R++AR LK N
Sbjct  468  FRISRQEARNLKYN 481

Sequence Alignment: 17. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 158.3 bits 667,  Expect = 1e-39
 Identities = 200/460 43%, Positives = 300/460 65%, Gaps = 56/460 12%
Query  2    QQPE---ENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALR 58
            QQP+   ++ CQ+Q LNA +P +R  SE G  E W+ N  +F+CAGVA+ R  ++R  L 
Sbjct  40   QQPQPRHQSQCQLQNLNALQPKHRFRSEAGETEFWDQNEDQFQCAGVAFLRHKIQRKGLL 99
Query  59   RPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQR 118
             P +++AP   +++QG G  G +FPGCP  Y+        SQSQ+         Q + QR
Sbjct  100  LPSFTSAPMLFYVEQGEGIHGAVFPGCPETYQ--------SQSQQ-------NIQDRPQR 144
Query  119  DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN 178
            D HQK+ R+ EGD++A+P GVA W++N+  + +V V+L D  N+ NQLD+  R+F LAG+
Sbjct  145  DQHQKLRRLKEGDVVALPAGVAHWIFNNGRSQLVLVALVDVGNDANQLDENFRKFFLAGS 204
Query  179  TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGN 238
             +   +R      QSR R+        Q Q R +      RG+  R E   QE  + G N
Sbjct  205  PQGGVVR----GGQSRDRN--------QRQSRTQ------RGE--REEEESQE--SGGNN 242
Query  239  IFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEE 298
            ++SGF   +L QAF +D R + + L  + E +  GAIV +  G+      ++R+  EEE 
Sbjct  243  VLSGFRDNLLAQAFGIDTR-LARKL--QNERDNRGAIVRMEHGFEWPEEGQRRQGREEEG 299
Query  299  YDEDEYEY-----------DEEDRR-RGRGSRGRGNGIEETICTASAKKNIGRNRSPDIY 346
             +E E ++           +EE+R  RGRG R  GNG+EET C+   K     + S D++
Sbjct  300  EEEREPKWQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKHRTPAS-SADVF 358
Query  347  NPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVV 406
            NP+ G + T N +NL IL++L  SAE G LY NA++  H+N NAHSI+Y  RG   +Q+V
Sbjct  359  NPRGGRITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIV 418
Query  407  DSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDN 466
              NG  ++DE+++ G+V+ VPQN AV  K+    FE++AFKT++   I+ +AG  S++  
Sbjct  419  SENGEAIFDEQVERGQVITVPQNHAVVKKAGRRGFEWIAFKTNANAKISQIAGRVSIMRG 478
Query  467  LPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQS 502
            LP +V+ANS+G+ RE+A +LK+N        P Q S
Sbjct  479  LPVDVLANSFGISREEAMRLKHNRQEVSVFSPRQGS 514

Sequence Alignment: 18. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 157.9 bits 665,  Expect = 1e-39
 Identities = 218/422 51%, Positives = 301/422 71%, Gaps = 70/422 16%
Query  1    RQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR 59
            RQ+  +++ CQ  RL+A  PDNR+E E G +E W+PN+++F CAGVAL R  ++ N L  
Sbjct  16   RQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLL 75
Query  60   PFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 119
            P YSNAPQ I++ QG G  G+ +PGCP  Y+ P+ QGR+          QG  QS + +D
Sbjct  76   PQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQ-QGRQ----------QG--QSGRFQD 122
Query  120  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 179
             HQK+ RF  GD+IA+P GVA W YN+ ++ VV V+L D +N+ NQLD+ PR+F+LAGN 
Sbjct  123  RHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNP 182
Query  180  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 239
            +  F   QQQ  QSR                                         G N+
Sbjct  183  KDVF--QQQQQHQSR-----------------------------------------GRNL 199
Query  240  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGG-LRILSPDRKRRADEEEE 298
            FSGF  E+L +AFQVD+R +++ L+ E   +  G IV V+   LR++ P R     + E 
Sbjct  200  FSGFDTELLAEAFQVDER-LIKQLKSE---DNRGGIVKVKDDELRVIRPSRS----QSER 251
Query  299  YDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND 358
              E E E ++E RR G+    R NGIEETICT   K+NI      DIY P+ G L T N 
Sbjct  252  GSESEEESEDEKRRWGQ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNS 307
Query  359  LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEEL 418
            LNL IL+WL  S E G LY+NAL + H+N N+HSIIY  +G+ +VQVVD+ GNRV+D E+
Sbjct  308  LNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEV 367
Query  419  QEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL 478
            +EG++LVVPQNFAV  +++ E FE+++FKT+ R   + LAG  SV+  +PEEV+AN++ +
Sbjct  368  REGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQI 427
Query  479  QREQARQLKNNN 490
             RE AR++K NN
Sbjct  428  SREDARKIKFNN 439

Sequence Alignment: 19. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 150.3 bits 632,  Expect = 2e-37
 Identities = 220/431 51%, Positives = 305/431 70%, Gaps = 60/431 13%
Query  1    RQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR 59
            RQQ  ++N CQ  +L+A  PDNR+E E G +ETW+PN+++F CAGVA++R  ++ N LR 
Sbjct  24   RQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRL 83
Query  60   PFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 119
            P YSNAP  ++I +G G  G + PGCP  Y+ P+ QG            Q   QS + +D
Sbjct  84   PEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQ-QG------------QQHGQSSRFQD 130
Query  120  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 179
             HQK++RF +GD+IA+P GVA W YN+ ++ VV V+L D +N+ NQLD +PR+FNLAGN 
Sbjct  131  KHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNP 190
Query  180  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 239
            E EF   QQQ +QSR R         QSQ                     Q+  N   NI
Sbjct  191  EDEF--QQQQQQQSRGRR--------QSQ---------------------QKSCN---NI 216
Query  240  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEY 299
            F GF  + L + FQV+ + +V+ L  + E +  GAIV V+G L+++ P R++     E  
Sbjct  217  FCGFDTKILAEVFQVE-QSLVKQL--QNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESE 273
Query  300  DEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDL 359
            +E EYE         RG RGR NG+EETICT   K+NI      DIY P+ G + + N L
Sbjct  274  EESEYE---------RGRRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSL 324
Query  360  NLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQ 419
            NL IL+WL  SAE G L  NAL V H+N NAHSI+Y  +G A+VQVVD+ GN V+D E+ 
Sbjct  325  NLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVS 384
Query  420  EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQ 479
            EG+++VVPQNFAV  +++ + FE+++FKT+ R  I+ LAG  SV+  +PEEV+AN++ + 
Sbjct  385  EGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQIS 444
Query  480  REQARQLKNNN 490
            RE AR++K NN
Sbjct  445  REDARKIKFNN 455

Sequence Alignment: 20. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 148.7 bits 625,  Expect = 7e-37
 Identities = 214/476 44%, Positives = 297/476 62%, Gaps = 35/476 7%
Query  3    QPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFY 62
            Q  +N CQ  RL A  P  RI SE G  E WNPN Q++ CAGV++ R  +  N L  P +
Sbjct  28   QQSQNECQINRLRASAPQTRIRSEAGTTEWWNPNCQQLRCAGVSVMRQTIEPNGLVLPSF 87
Query  63   SNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQ 122
            +NAPQ ++I QGRG  G++ PGC   +++  +Q  + QS+    R+Q         D HQ
Sbjct  88   TNAPQLLYIVQGRGIQGIVMPGCAETFQD--SQQWQHQSRG---RFQ---------DQHQ 133
Query  123  KVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQE 182
            KV RF +GD+IA+P GV  W YND +  VV ++L DT N+ NQLD  PRRF+LAGN E+E
Sbjct  134  KVRRFRQGDIIALPQGVVHWSYNDGNERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEE 193
Query  183  F--LRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSP--RGQHSRRERAGQEEENEGGN 238
               LR   Q  Q R      S    + +  +EE E +P  R +H   E  G+E  +   N
Sbjct  194  QRQLRRLAQQMQGRSERGEESE-EEEGEGEEEEEEDNPSRRSRHQEEEEQGRESSSCN-N 251
Query  239  IFSGFTPEFLEQAFQVDDRQI--VQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEE 296
            ++  F   FL QAF VD   I  +Q +RG       G I+ VR  L++++P R     EE
Sbjct  252  LLCAFDRNFLAQAFNVDHDIIRKIQRVRGN-----RGTIIRVRDRLQVVTPPRM----EE 302
Query  297  EEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTA 356
            EE +E +    E+  R  RG   + NG+EET C+   K+N+      DI+NPQAG + T 
Sbjct  303  EEREERQ---QEQRYRHTRGG-SQDNGLEETFCSMRIKENLADPERADIFNPQAGRISTL 358
Query  357  NDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDE 416
            N +NL IL+ L  SAE G LY  A ++ ++N NAH I+Y LRG A VQVV+ NG+ V+D+
Sbjct  359  NRFNLPILQRLELSAERGVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVFDD 418
Query  417  ELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSY 476
             +++G++L VPQNFA   ++ +E  E+++F T+S  +   +AG  S +  LPEEVVA SY
Sbjct  419  NVEQGQLLTVPQNFAFMKQAGNEGAEWISFFTNSEATNTPMAGSVSFMRALPEEVVAASY 478
Query  477  GLQREQARQLKNNNPFKFFVPPSQQSPRAVA 507
             + RE AR++K NN   FF  PSQ   RA A
Sbjct  479  QVSREDARRIKFNNKNTFFFTPSQSERRADA 509

Sequence Alignment: 21. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 138.0 bits 578,  Expect = 1e-33
 Identities = 207/444 46%, Positives = 289/444 65%, Gaps = 60/444 13%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            +QQ  +  CQ Q LNA  P  RIESE G  E W+ N ++++CA VA+ R  ++   L  P
Sbjct  35   QQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVP 94
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             Y NAP+ +++ QG G  G +FPGCP  ++E  +Q R S+S+R          SQQ  + 
Sbjct  95   SYDNAPELVYVVQGSGIHGAVFPGCPETFQE-ESQSR-SRSER----------SQQSGEQ 142
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQKV    EGD+IA+P GVA W+YN+  + +V V+L D  N++NQLDQ+ R+F L G+ +
Sbjct  143  HQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGSPQ 202
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QE     Q S QSR RS        QS             Q SRR + GQ+      NI+
Sbjct  203  QEI----QGSGQSRSRS--------QS-------------QSSRRGQQGQQ----SNNIL 233
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            S F  E L Q+F +D  Q+ + L  + E  + G IV V+  L +LSP R+          
Sbjct  234  SAFDEEILAQSFNIDT-QLARRL--QKEKRQRGIIVRVQEDLEVLSPHRQ---------- 280
Query  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
            E E EY+EE  RR R      NG+EET CT + K NI      D+YNP+ G + + N LN
Sbjct  281  EQEQEYEEERERRQR------NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALN 334
Query  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
            L ILR+L  SA+ G L+R+A++  H+N NAHSI+Y  RG   +Q+V  NG  V+DEE++E
Sbjct  335  LPILRFLQLSAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIRE 394
Query  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
            G+++VVPQNFAV  ++ S+ FE+V+FKT+     + LAG  SV   LP +V+ NS+ + R
Sbjct  395  GQLVVVPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISR 454
Query  481  EQARQLKNNNPFKFFVPPSQQSPR 504
            E AR+LK +        P   S R
Sbjct  455  EDARRLKESRSETTIFAPGSSSQR 478

Sequence Alignment: 22. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 131.9 bits 551,  Expect = 8e-32
 Identities = 194/433 44%, Positives = 271/433 62%, Gaps = 74/433 17%
Query  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
            Q P   AC+++ L AQ P  R E+E  + E W+ +N EF+CAGV + R  +R   L  P 
Sbjct  43   QSPR--ACRLENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPG 100
Query  62   YSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSH 121
            +SNAP+ IF+ QG G  G+  PGC   Y+   T  RRSQS                +D H
Sbjct  101  FSNAPKLIFVAQGFGIRGIAIPGCAETYQ---TDLRRSQSA-----------GSAFKDQH 146
Query  122  QKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ 181
            QK+  F EGDL+ VP GV+ W+YN   +D+V + + DT N  NQ+D + R+F LAG    
Sbjct  147  QKIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFYLAG---- 202
Query  182  EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFS 241
                                      +P Q ER      + SR+  +G++     GNIFS
Sbjct  203  --------------------------RPEQVERGVEEWERSSRKGSSGEK----SGNIFS 232
Query  242  GFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDE 301
            GF  EFLE+AFQ+D   +V+ L+G  E +E   IV V   + +L P++            
Sbjct  233  GFADEFLEEAFQIDG-GLVRKLKG--EDDERDRIVQVDEDFEVLLPEK------------ 277
Query  302  DEYEYDEEDRRRGRGSRGRG---NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND 358
                 DEE+R RGR         NG+EETICT   K+NIGR+   D++NP+ G + TAN 
Sbjct  278  -----DEEERSRGRYIESESESENGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANY 332
Query  359  LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEEL 418
              L ILR +  SAE G LY NA+   HY  N+HS++Y  RG A VQVVD+ G  V+D E+
Sbjct  333  HTLPILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEV 392
Query  419  QEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL 478
            +EG+VL++PQNF V  ++    FE++AFKT+       LAG  S +  LP  V++N Y +
Sbjct  393  REGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVLSNMYRI 452
Query  479  QREQARQLK-NNNPFKFFVPPSQQSPR 504
             RE+A++LK      + + P   Q  R
Sbjct  453  SREEAQRLKYGQQEMRVLSPGRSQGRR 479

Sequence Alignment: 23. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 131.1 bits 548,  Expect = 2e-31
 Identities = 195/457 42%, Positives = 286/457 62%, Gaps = 99/457 21%
Query  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
            +Q   + C  QRL A  P  R+ SE G  E W+ +  EF CAG    R+V++   L  P 
Sbjct  37   HQQFHHQCDVQRLTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPS 96
Query  62   YSNAPQEIFIQQGRGYFGLIFPGCPR------HYEEPHTQ----GRRSQSQRPPRRLQ-- 109
            YSNAP   F++QGRG  G++ PGCP        +E P++Q     R+S+S+   R  Q  
Sbjct  97   YSNAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESSRGDQRT 156
Query  110  ----------GEDQSQQ----------QR---------------------------DSHQ 122
                      G+ +++Q          QR                           D HQ
Sbjct  157  RQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQHQ 216
Query  123  KVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQE 182
            K+ R  +GD+I  P GV  W +ND D D+++++L D N+  NQLD   R F LAG +   
Sbjct  217  KIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITLYDANSFQNQLDGNVRNFFLAGQS--- 273
Query  183  FLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSG 242
                 +QSR+ RR           SQ RQ   E S R     RE    E   E  NI++G
Sbjct  274  -----KQSREDRR-----------SQ-RQTREEGSDR---QSRESDDDEALLEA-NILTG 312
Query  243  FTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDED 302
            F  E L++ F+  D++ +  LRG+  +++ G IV  R  L++  P         EEY+E 
Sbjct  313  FQDEILQEIFRNVDQETISKLRGD--NDQRGFIVQARD-LKLRVP---------EEYEE- 359
Query  303  EYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLL 362
            E + +  DR+RG GS GR NG+E+  C    K+N+ R    D++NP+AG + T N  NL 
Sbjct  360  ELQRERGDRKRG-GS-GRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLP 417
Query  363  ILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGH 422
            IL ++  SA++  LY+NA++   +N NAHS +Y  RG   VQVV   G  V+D+ +Q G+
Sbjct  418  ILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQ 477
Query  423  VLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQ 482
            +LVVPQ FAV  K+  E +E+V +K D     + +AG+ SV+  +P EV+ANSY +  ++
Sbjct  478  ILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKE 537
Query  483  ARQLKNN-NPFKFFVP 497
            A +LKN     + F+P
Sbjct  538  AFRLKNGRQEVEVFLP 553

Sequence Alignment: 24. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 129.1 bits 539,  Expect = 5e-31
 Identities = 198/435 45%, Positives = 278/435 63%, Gaps = 69/435 15%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            +QQ  +  CQ Q LNA  P  RIESE G  E W+ N ++++CA VA+ R  ++   L  P
Sbjct  35   QQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVP 94
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
             Y+NAP+ +++ QG G  G +FPGCP  ++E      RSQ  R  R       SQQ  + 
Sbjct  95   SYNNAPELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSER-------SQQSGEQ 147
Query  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
            HQKV    EGD+IA+P GVA W+YN+  + +V V+L D  N++NQLDQ+ R+F L G+ +
Sbjct  148  HQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGSPQ 207
Query  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
            QE     Q   QS             SQ              SR  R GQ+      NI+
Sbjct  208  QEI----QGGGQS------------WSQ--------------SRSSRKGQQ----SNNIL 233
Query  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            S F  E L Q+F +D  Q+V+ L  + E ++ G IV V+  L++LSP R+     E+EY 
Sbjct  234  SAFDEEILAQSFNIDT-QLVKKL--QREEKQRGIIVRVKEDLQVLSPQRQ-----EKEYS 285
Query  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
            +                    NG+EET CT + K NI      D+YNP+ G + + N LN
Sbjct  286  D--------------------NGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALN 325
Query  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
            L ILR+L  S E G LY+NA+   H+N NAHSI+Y  RG   +Q+V  NG  V+DEE++E
Sbjct  326  LPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIRE 385
Query  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
            G+++VVPQNFAV  ++ S+ FE+V+FKT+    I+ LAG  SV+  LP +V+ NS+ + R
Sbjct  386  GQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISR 445
Query  481  EQARQLKNNNPFKFFVPPSQQSPR 504
            E A  LK +        P  +S R
Sbjct  446  EDAWNLKESRSEMTIFAPGSRSQR 469

Sequence Alignment: 25. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 128.9 bits 538,  Expect = 7e-31
 Identities = 190/456 41%, Positives = 285/456 62%, Gaps = 71/456 15%
Query  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
            +Q  ++ C  QRL A  P  R+ SE G  E W+ +  EF CAG    R+V++   L  P 
Sbjct  37   HQQFQHQCDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPS 96
Query  62   YSNAPQEIFIQQGRGYFGLIFPGCPR------HYEEPHTQ----GRRSQSQRPPRRLQ-- 109
            YSNAP   F++QGRG  G++ PGCP        +E P +Q     R+S+S    R  Q  
Sbjct  97   YSNAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESSRGDQRS 156
Query  110  ----------GEDQSQQQR-------DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVV 152
                      G+ +S+Q         D HQK+ R  +GD+I  P GV  W +N+ D D++
Sbjct  157  RQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLI 216
Query  153  AVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQE 212
            +++L D N+  NQLD+  R F LAG +        +QSR+ RR          Q Q R+E
Sbjct  217  SITLYDANSFQNQLDENVRNFFLAGQS--------KQSREDRRS---------QRQTREE 259
Query  213  EREFSPRGQHSRRERAGQEEENE-GGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEE 271
              +        R+ R  Q++E     NI+SGF  E L++ F+  D++ +  LRGE  +++
Sbjct  260  GSD--------RQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETISKLRGE--NDQ 309
Query  272  EGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTA 331
             G IV  R  L++  P         EEY+E E + +  DR+RG GS GR NG+E+  C  
Sbjct  310  RGFIVQARD-LKLRVP---------EEYEE-ELQRERGDRKRG-GS-GRSNGLEQAFCNL 356
Query  332  SAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAH 391
              ++N+ R    D++NP+AG + T +  NL IL ++  SA++  LY+NA++   +N NAH
Sbjct  357  KFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAH 416
Query  392  SIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSR 451
            S +Y  RG   VQVV   G  V+D+ +Q G++LVVPQ FAV  K+  E +E+V +K D  
Sbjct  417  SALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDN 476
Query  452  PSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNN-NPFKFFVP 497
               + +AG+ SV+  +P EV+ANSY +  ++A +LKN     + F P
Sbjct  477  AITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRP 523

Sequence Alignment: 26. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 127.7 bits 533,  Expect = 1e-30
 Identities = 192/424 45%, Positives = 272/424 64%, Gaps = 76/424 17%
Query  9    CQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQE 68
            C+ +RL AQ P  R ESE G  E W+ NNQ+FECAGVA  R V++   L  P Y+NAPQ 
Sbjct  49   CRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLPHYNNAPQL 108
Query  69   IFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFD 128
            +++ +GRG  G + PGC   +E      R +Q    PR    +D+ ++  D HQKV +F 
Sbjct  109  LYVVRGRGIQGTVIPGCAETFE------RDTQ----PR----QDRRRRFMDRHQKVRQFR 154
Query  129  EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQ 188
            +GD++A+P G+ +W+YN+    ++ V+L DT N  NQLDQ  R F LAGN         Q
Sbjct  155  QGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGN--------PQ 206
Query  189  QSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFL 248
              RQS      +    PQ++ +Q E +                      NIF+GF  E L
Sbjct  207  GGRQSY-----FG--RPQTEKQQGETK----------------------NIFNGFDDEIL 237
Query  249  EQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDE 308
              AF VD  Q  + L+G  + +  G IV     L I+ P      +EEE ++ D Y    
Sbjct  238  ADAFGVD-VQTARRLKG--QDDLRGRIVRAER-LDIVLPGE----EEEERWERDPYS--- 286
Query  309  EDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLG 368
                   G+    NG+EET+CTA  ++N+      D+YNP+ G + + N L L +L WL 
Sbjct  287  -------GA----NGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLR 335
Query  369  PSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQ 428
             SAE G LYRN L   H+N NAHSIIY  RG    QVV   G  V+D  ++EG++++VPQ
Sbjct  336  LSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQ 395
Query  429  NFAVAGK-SQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLK 487
            N+ VA + SQ E +E+++FKT+     + LAG  S I  +PEEVV  +Y + R++AR+LK
Sbjct  396  NYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLK 455
Query  488  -NNNPFKFFVPPSQQS-PRA 505
             N    + F   S+ S PR+
Sbjct  456  YNREESRVFSSTSRYSWPRS 475

Sequence Alignment: 27. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 127.4 bits 531,  Expect = 1e-30
 Identities = 175/388 45%, Positives = 256/388 65%, Gaps = 61/388 15%
Query  26   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 85
            E G  E W+ NN++++CA VA+ R  +++  L  P Y+N  +  ++ QGRG  G +FPGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  86   PRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYN 145
            P  Y++ + Q    QS+      Q E    Q  D HQKV ++ EGD++A+PTG A W+YN
Sbjct  61   PETYQDQQQQ----QSH------QSEGSRSQ--DQHQKVRQLREGDIVAMPTGSAHWIYN 108
Query  146  DHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSP 205
            +  + +V V+L D  N+DNQLDQ+ R+F + GN +QE+  Y Q S+ SR           
Sbjct  109  NGQSQLVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQ-SQGSRSY--------- 158
Query  206  QSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRG 265
              Q  Q E      G  SRR        + GGNIF+GF   +L  AF V+  +I++ L  
Sbjct  159  --QGSQGE------GG-SRR--------SSGGNIFNGFDERLLADAFNVNP-EIIRRL-- 198
Query  266  ETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIE 325
            +      G IV V   L +L P R  + ++E+E+                  RGR NG+E
Sbjct  199  QKPQLPRGIIVRVEEELEVLRPQRGEQ-EQEQEF------------------RGRDNGLE 239
Query  326  ETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAH 385
            ET CT   K NI      D+YNP+ G + T N +NL +LRW+  SAE GNLY+NA +  H
Sbjct  240  ETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLAPH 299
Query  386  YNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVA 445
            +N N+HS++Y  RG   VQ+V  NGN VYD +++EG+++VVPQ +AV  K+ ++ +E+++
Sbjct  300  WNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKKASNQGLEWIS 359
Query  446  FKTDSRPSIANLAGENSVIDNLPEEVVAN 474
            FKT+     + LAG NSVI  LP +V+ N
Sbjct  360  FKTNDNAETSQLAGRNSVIRALPLDVIQN 388

Sequence Alignment: 28. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 127.4 bits 531,  Expect = 1e-30
 Identities = 175/389 44%, Positives = 256/389 65%, Gaps = 60/389 15%
Query  26   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 85
            E G  E W+ NN++++CA VA+ R  +++  L  P Y+N  +  ++ QGRG  G +FPGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  86   PRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYN 145
            P  Y++ + Q    QS+      Q E    Q  D HQKV ++ EGD++AVPTG A W+YN
Sbjct  61   PETYQDQQQQ----QSH------QSEGSRSQ--DQHQKVRQLREGDIVAVPTGSAHWIYN 108
Query  146  DHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSP 205
            +  + +V V+L D  N+DNQLDQ+ R+F + GN +QE+  Y Q S+ SR           
Sbjct  109  NGQSQLVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQ-SQGSRSY--------- 158
Query  206  QSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRG 265
              Q  Q E      G  SRR        + GGNIF+GF   +L  AF V+  +I++ L  
Sbjct  159  --QGSQGE------GS-SRR--------SSGGNIFNGFDERLLADAFNVNP-EIIRRL-- 198
Query  266  ETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIE 325
            +      G IV V   L +L P R +  ++E+E+                  RGR NG+E
Sbjct  199  QKPQLPRGIIVRVEEELEVLRPQRGQEQEQEQEF------------------RGRDNGLE 240
Query  326  ETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAH 385
            ET CT   K NI      D+YNP+ G + T N +NL +LRW+  SAE GNLY+NA +  H
Sbjct  241  ETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLAPH 300
Query  386  YNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVA 445
            +N N+HS++Y  RG   VQ+V  NGN VYD +++EG+++VVPQ +AV  ++ ++ +E+++
Sbjct  301  WNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKRASNQGLEWIS 360
Query  446  FKTDSRPSIANLAGENSVIDNLPEEVVAN 474
            FKT+     + LAG NSVI  LP +V+ N
Sbjct  361  FKTNDNAETSQLAGRNSVIRALPLDVIQN 389

Sequence Alignment: 29. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 125.5 bits 523,  Expect = 7e-30
 Identities = 180/450 40%, Positives = 266/450 59%, Gaps = 50/450 11%
Query  1    RQQPE-ENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR 59
            RQQ + ++ C  QRL A  P  R+ SE G  E W+ +  EF C G    R+V++   L  
Sbjct  37   RQQHQFQHQCDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLL 96
Query  60   PFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQR- 118
            P YSNAP   F++QGRG  G++ PGCP  ++   ++    QSQR     Q E + +  R 
Sbjct  97   PSYSNAPYITFVEQGRGVQGVVIPGCPETFQSD-SEFEYPQSQRGRHSRQSESEEESSRG 155
Query  119  DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN 178
            D HQK+ R  EGD+I  P GV  W +ND + D+++V+L D N+   QLD+  R F LAG 
Sbjct  156  DQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQ 215
Query  179  TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGN 238
            +++E  R +   RQSR                                 +  +E   G N
Sbjct  216  SQRE-TREEGSDRQSRE--------------------------------SDDDEALLGAN 242
Query  239  IFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEE 298
            I+SGF  E L + F+  DR+ +  LRG  E+++ G IV  +        D K R  ++ E
Sbjct  243  ILSGFQDEILHELFRDVDRETISKLRG--ENDQRGFIVQAQ--------DLKLRVPQDFE 292
Query  299  YDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND 358
               +EYE +  DRRRG+G  GR NG+E+  C    ++N     +  ++NP+AG + T N 
Sbjct  293  ---EEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNS 349
Query  359  LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEEL 418
             +L IL +L  SA++  LY+NA+    +N NAHS +Y  RG   VQVV   G  V+D+++
Sbjct  350  NSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKV 409
Query  419  QEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL 478
            Q G++LVVPQ FAV  K+  E +E+V +K       + + G  SV+  +P EV+ANSY +
Sbjct  410  QRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDI 469
Query  479  QREQARQLKNN-NPFKFFVP 497
              ++A +LKN     + F P
Sbjct  470  STKEAYKLKNGRQEVEVFRP 489

Sequence Alignment: 30. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 124.2 bits 517,  Expect = 1e-29
 Identities = 174/389 44%, Positives = 250/389 64%, Gaps = 60/389 15%
Query  26   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 85
            E G  E W+ NNQ+++CA VA+ R  +++N L  P Y+N P+  ++ QGRG  G + PGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  86   PRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYN 145
            P  Y++ + Q    QS   P       +  + +D HQKV +  EGD+IA+PTG A W+YN
Sbjct  61   PETYQDEQQQ---QQSFSYP------SEGSRSQDQHQKVRQIREGDIIALPTGSAHWIYN 111
Query  146  DHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSP 205
            +  + +V V+L D  N+DNQLDQ+ R+F L GN + ++    Q + QS+           
Sbjct  112  NGQSQLVLVALVDVGNSDNQLDQYFRKFYLGGNPQPQL----QGTSQSQ----------- 156
Query  206  QSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRG 265
                R +ER     G  SRR            NIF+GF   +L +AF V+   I    R 
Sbjct  157  --GGRYQERLGG--GDSSRR----------SANIFNGFDERLLAEAFNVNPELI---RRL 199
Query  266  ETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIE 325
            +    + G I+ V   +R+L+P R      +E Y+ D Y              GR NG+E
Sbjct  200  QRPQMQRGIIIRVEEEFRVLTPQRG-----QESYESDPY--------------GRYNGVE 240
Query  326  ETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAH 385
            ET+CT   + NI      D+YNP+AG + T N LNL +LRWL  SAE GNLY+NAL   H
Sbjct  241  ETLCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKGNLYKNALTAPH 300
Query  386  YNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVA 445
            +N NAHSI+Y  RG   VQ+V  NGN V+D E++EG+++VVPQ FAV  ++ +  +E+++
Sbjct  301  WNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIVVPQGFAVVKRASNRGLEWIS 360
Query  446  FKTDSRPSIANLAGENSVIDNLPEEVVAN 474
            FKT+       LAG  SV+  LP +V+ N
Sbjct  361  FKTNDYAMTNQLAGRVSVLRALPLDVIQN 389

Sequence Alignment: 31. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 124.5 bits 519,  Expect = 2e-29
 Identities = 221/459 48%, Positives = 305/459 66%, Gaps = 110/459 23%
Query  7    NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAP 66
            N CQ+  LNA  PD+R+ESEGG I+TWN  + E++CAGV +S+L L RN L  P YS  P
Sbjct  30   NECQLNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYP 89
Query  67   QEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHR 126
            + I I QG+G +G+  PGCP  +EEP+ Q  R  S+          Q QQ +DSHQK+  
Sbjct  90   RMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSR---------SQKQQLQDSHQKIRH 140
Query  127  FDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRY 186
            F+EGD++ +P GV +W YN  D  VVA+SL DT+N +NQLDQ PR F LAGN + E+   
Sbjct  141  FNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEY--- 197
Query  187  QQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPE 246
                           P + Q Q +Q+      +GQH       QEEE EGG+++SGF+  
Sbjct  198  ---------------PETMQQQQQQKSHGGRKQGQHQ------QEEEEEGGSVLSGFSKH 236
Query  247  FLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDE--- 303
            FL Q+F  ++  I + L  ++  +E   IVTV GGL ++SP  + + DE+E+ DED+   
Sbjct  237  FLAQSFNTNE-DIAEKL--QSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDE 293
Query  304  --------------YEYDE-----EDRRR-GRGSRG------------------------ 319
                           E DE     ED+ R  R S+G                        
Sbjct  294  QIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSRE 353
Query  320  ------------------RG----NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAN 357
                              RG    NG+EE ICT    +NI R    D YNP+AG + T N
Sbjct  354  WRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLN 413
Query  358  DLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEE 417
             L L  LR +  SA+Y  LY+N ++  H+N NA+S+IY  RG+  V+VV+  GN V+D E
Sbjct  414  SLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGE 473
Query  418  LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYG 477
            L+ G++LVVPQNF VA ++  + FEY+ FKT      + L     V   +P EV+A+SY 
Sbjct  474  LRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYN 530
Query  478  LQREQARQLKNNNPFKFFV-PPSQQ-SPR 504
            L++ Q  +LK    +  +V P SQQ SPR
Sbjct  531  LRQSQVSELKYEGNWGPLVNPESQQGSPR 559

Sequence Alignment: 32. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 116.1 bits 482,  Expect = 4e-27
 Identities = 193/440 43%, Positives = 275/440 62%, Gaps = 68/440 15%
Query  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
            +Q E   C+ QRL AQ P  R+E+E G  E W+  +Q+F CAGVA  R  +R   L  P 
Sbjct  24   EQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPV 83
Query  62   YSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSH 121
            Y+NAP+  ++ QGRG +G++ PGCP  ++        S SQ    R Q E++ + Q D H
Sbjct  84   YTNAPKLYYVTQGRGILGVLMPGCPETFQ--------SMSQFQGSREQEEERGRFQ-DQH 134
Query  122  QKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ 181
            QKVH + +GD+IA+P GVA+W YND D D+V V +  T ++ NQLDQ PR F LAGN + 
Sbjct  135  QKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQ- 193
Query  182  EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFS 241
               R Q+Q  +  R  L                            R GQ+   +  N+F 
Sbjct  194  ---RSQKQ--RGERYGL----------------------------RGGQQILAD--NVFK 218
Query  242  GFTPEFLEQAFQVD-DRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
            GF  E L   +    D +  + +RG  E ++ G IV V  GL+++ P R R     EE +
Sbjct  219  GFNMEALADVLGFGMDTETARKVRG--EDDQRGHIVRVEQGLKVIRPPRIR-----EELE 271
Query  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
            + E          G G     NG+EETIC+A+  +NI      D YNP+AG L T N L 
Sbjct  272  QQE----------GGGY----NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLK 317
Query  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
            + IL +L  SA  G LY NA+    +  NA+S++Y +RG A VQ+VD  G  V+D+ L+E
Sbjct  318  VPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLRE 377
Query  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
            G+++VVPQNF V  ++ S  FE+V F T+     +  AG  S +  +P  V+AN+Y L +
Sbjct  378  GQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQ 437
Query  481  EQARQLK-NNNPFKFFVPPSQQSPRAVA 507
            E+AR++K N +   +F P S+   RA A
Sbjct  438  EEARRIKLNRDEAVLFQPGSRSRGRASA 465

Sequence Alignment: 33. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 113.7 bits 471,  Expect = 2e-26
 Identities = 169/383 44%, Positives = 246/383 64%, Gaps = 63/383 16%
Query  26   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 85
            E G  E W+ NN +++CA VA+ R  +++N L  P Y+N  +  ++ QGRG  G +FPGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  86   PRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYN 145
            P  Y++        Q Q+   + QG  +SQ   D HQKV +  EGD+IA+PTG A W+YN
Sbjct  61   PETYQD--------QQQQQSYQSQG-SRSQ---DQHQKVRQIREGDIIALPTGAAHWIYN 108
Query  146  DHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSP 205
            +  + +V V+L D  N+DNQLDQ+ R+F L GN + E+     Q    R++   Y     
Sbjct  109  NGGSQLVLVALVDVGNSDNQLDQYFRKFYLGGNPQPEL-----QGTSQRQQGGGY----- 158
Query  206  QSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRG 265
              Q  Q        G  SRR           GN+F+GF   +L  AF V+  ++++ L  
Sbjct  159  --QGSQ------GGGGGSRR-----------GNMFNGFDERLLADAFNVNP-ELIRRL-- 196
Query  266  ETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIE 325
            +    + G IV V   +R+LSP R +  ++E+E D D                   NG+E
Sbjct  197  QRPQMQRGIIVRVEEEFRVLSPQRGQEQEQEQEQDCD-------------------NGVE 237
Query  326  ETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAH 385
            ET CT   + NI      D+YNP+ G + T N +NL +LRWL  SAE GNLY+NAL   H
Sbjct  238  ETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNLYQNALTSPH 297
Query  386  YNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVA 445
            +N N HSI+Y  RG   +Q+V  NGN V++ E++EG+++V+PQ FAV  K+ +  +E++A
Sbjct  298  WNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIVIPQGFAVVKKASNRGLEWIA 357
Query  446  FKTDSRPSIANLAGENSVIDNLPEEV 471
            FKT+       LAG  SV+  LP +V
Sbjct  358  FKTNDNAMTNQLAGRVSVMRALPLDV 383

Sequence Alignment: 34. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 110.6 bits 458,  Expect = 2e-25
 Identities = 168/424 39%, Positives = 266/424 62%, Gaps = 89/424 20%
Query  6    ENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA 65
            ++AC +  L+  +P   I+SE G +E W+ N+ +  CAGV+++RLV+++  L  P + ++
Sbjct  34   KDACNLDNLDVLQPTEVIKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSS 93
Query  66   PQEIFIQQGRGYFGLIFPGC--------PRHYEEPHTQGRRSQS-QRPPRRLQGEDQSQQ 116
            P   ++ QG G  G + PGC        P + ++ + QG++ Q  Q+  +  QG+   Q 
Sbjct  94   PFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQGQQGQQGQQGQQGQQGQQG 153
Query  117  Q--------------------RDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSL 156
            Q                    RD HQKV     GD IA+  G A W+YN  D  ++ VSL
Sbjct  154  QQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDAIAMTPGSAQWIYNTGDQPLIIVSL 213
Query  157  TDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREF 216
             D  N  NQLD+ PR F LAGN +Q   + QQQ +Q                        
Sbjct  214  IDIANYQNQLDRNPRTFRLAGNNQQGSSQQQQQQQQ------------------------ 249
Query  217  SPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIV 276
                                 NI+SGF P+ L QA+++D R + Q L  + + ++ G IV
Sbjct  250  ---------------------NILSGFDPQVLAQALKIDVR-LAQEL--QNQQDKRGNIV 285
Query  277  TVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKN 336
             V+G ++++ P   R+A E E++             RG     + NG+EETIC+    +N
Sbjct  286  RVKGPFQVVRPPL-RQAYESEQWRHP----------RGPPQSPQDNGLEETICSMRTHEN 334
Query  337  IGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYR 396
            I      DIY P  G + + N   L IL+++  SA  G L  +A+ +  YN NA+ I+Y 
Sbjct  335  IDDPARADIYKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEILYC 394
Query  397  LRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN 456
             +G+A +QVV+ NG  V D+++Q+G+++V+PQ FA   +SQ+ NFE+++FKT++   I+ 
Sbjct  395  TQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSQN-NFEWISFKTNANAMIST 453
Query  457  LAGENSVIDNLPEEVVANSYGLQREQARQLKNN 489
            LAG  S +  LP EV+ N+Y +  E+AR++K N
Sbjct  454  LAGRTSALRALPLEVITNAYQISLEEARKIKFN 486

Sequence Alignment: 35. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 110.2 bits 456,  Expect = 3e-25
 Identities = 177/418 42%, Positives = 256/418 61%, Gaps = 75/418 17%
Query  9    CQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQE 68
            C+FQR++  +P  RI+SEGG  E W+   ++F+CAG+   R  +R N L  P Y  +P+ 
Sbjct  34   CRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRL 93
Query  69   IFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQ--RDSHQKVHR 126
            ++I++G+G   ++ PGC   Y     Q  RSQ  R   R +  +Q  +   RD HQKVHR
Sbjct  94   VYIERGQGLISIMVPGCAETY-----QVHRSQ--RTMERTEASEQQDRGSVRDLHQKVHR 146
Query  127  FDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRY 186
            + +GD++A+P+G A W YND   D+VAVS+ D N+  NQLDQ  R F LAG         
Sbjct  147  LRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGV------- 199
Query  187  QQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPE 246
                                  PR  E+E     Q++R+            NIF  F  E
Sbjct  200  ----------------------PRSGEQE-----QQARQTFH---------NIFRAFDAE 223
Query  247  FLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEY 306
            +L +AF V    I    R ++E EE G IV  R  +  + PD        EE  E E+  
Sbjct  224  LLSEAFNVPQETIR---RMQSEEEERGLIVMARERMTFVRPD--------EEEGEQEH-- 270
Query  307  DEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRW 366
                  RGR      NG+EET CT   + N+   R  DI++ QAG +   +   L IL++
Sbjct  271  ------RGRQL---DNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKY 321
Query  367  LGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVV 426
            +  SAE GNLY NAL    ++   H+I+Y  RG A+VQVVD NG  + ++ + +G ++VV
Sbjct  322  MDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVV 381
Query  427  PQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQL 486
            PQ +    ++ +  FE+VAFKT   P  + LAG  SVI  +P +V+ NSY +   QA+ L
Sbjct  382  PQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQAL 441
Query  487  KNNNPFK-FFVPP 498
            K N   + F++ P
Sbjct  442  KMNRGSQSFLLSP 454

Sequence Alignment: 36. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 45.9 bits 174,  Expect = 6e-06
 Identities = 69/254 27%, Positives = 112/254 44%, Gaps = 28/254 11%
Query  238  NIFSGFTPEFLEQAFQVDDRQ---IVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRAD 294
            +++SGF    L  AF V   Q   I+ + RG       G     R  L  +   ++R   
Sbjct  190  SVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQ 249
Query  295  EEE--EYDEDEYEYDEED----RRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNP 348
            E+E    D+DE E +E+D    R   +   G+G+      C    K  +    SP  YN 
Sbjct  250  EKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGD------CRVQRKHKLAH--SPGSYNL 301
Query  349  QAGSLKTANDLNLLI---------LRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRG 399
                    ND    I         L+         NL   A++  H N  A      LRG
Sbjct  302  YDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRG 361
Query  400  RAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAG-KSQSENFEYVAFKTDSRPSIAN-L 457
               +QVV  NG    + ++ EG V+ +P+ F      S    +E+  F T +R +    L
Sbjct  362  SGTIQVVFPNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFL 421
Query  458  AGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPS 499
             G++S++ ++    +A ++G+  EQ  ++         +P S
Sbjct  422  VGKSSLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTS 463

Sequence Alignment: 37. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 42.7 bits 160,  Expect = 5e-05
 Identities = 109/386 28%, Positives = 187/386 48%, Gaps = 78/386 20%
Query  85   CPRHYEEPHTQGRRSQSQRPPRRL-QGEDQSQQQRDSH----QKV---HRFDEGDLIAVP 136
            C R+Y+E   QGR    +  PRR  +G ++ QQ+ + +    Q +   H  +EG++  + 
Sbjct  35   CERQYKE--QQGRERGPEASPRRESKGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLE 92
Query  137  TGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRR 196
                   + +    +  +     N     LD  P  F L  + + E +    + R +   
Sbjct  93   R------FAERTELLRGIE----NYRVVILDANPNTFMLPHHKDAESVIVVTRGRAT--- 139
Query  197  SLPYSPYSPQSQPRQEERE-FSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVD 255
                      +   QE RE F+       R  AG  E      + +  + E LE    V 
Sbjct  140  ---------LTLVSQETRESFNLECGDVIRVPAGATEY-----VINQDSNERLEM---VK 182
Query  256  DRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRG- 314
              Q V N     E    GA    +  LR++S D    A      D  E  +D++++R G 
Sbjct  183  LLQPVNNPGQVREYYAAGAKSPDQSYLRVFSND-ILVAALNTPRDRLERFFDQQEQREGV 241
Query  315  --RGSRGRGNGIEETICTAS----AKKNIG-----RNRSPDIYNPQAGSLKTANDLNLLI 363
              R S+ +   + +   +A      +++ G     ++  P  Y+ Q G +  A       
Sbjct  242  IIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPS-YSNQFGQFFEACPEEHRQ 300
Query  364  LRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRA-------HV--QVVDSNGNRVY 414
            L+ +     Y  + R A+ V HYN+ A  ++Y + G         HV  Q  +  G R  
Sbjct  301  LQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQ 360
Query  415  DEE------------LQEGHVLVVPQNFAVA-GKSQSENFEYVAFKTDSRPSIAN-LAGE 460
            +EE            L  G ++V+P    +A   SQ+EN+  + F  +   +  N LAG+
Sbjct  361  EEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQRNFLAGQ 420
Query  461  NSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQSPR 504
            NS+I+ L  E    S+ + RE+  ++  +    +FVP  +QS R
Sbjct  421  NSIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR 464

Sequence Alignment: 38. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 42.6 bits 160,  Expect = 0.0001
 Identities = 128/454 28%, Positives = 206/454 45%, Gaps = 88/454 19%
Query  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
            R+  E+  C+ +R   QR     E + G  +  +P  Q   C          RR   +  
Sbjct  283  RRGQEQQLCR-RRCEQQRQQEERERQRGR-DRQDPQQQYHRCQ---------RRCQTQE- 330
Query  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRR-SQSQRPPRRLQGEDQSQQQRD 119
                +P+     Q R         C R+Y+E   QGR     Q  PRR     + +QQR 
Sbjct  331  ---QSPERQRQCQQR---------CERQYKEQ--QGREWGPDQASPRRESRGREEEQQR- 375
Query  120  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 179
             H   +   +G      +G     Y +  T+   +     N     L+  P  F L  + 
Sbjct  376  -HNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHK 434
Query  180  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 239
            + E +    + R     +L +      SQ R+E   F+       R  AG  E      +
Sbjct  435  DAESVIVVTRGRA----TLTFV-----SQERRE--SFNLEYGDVIRVPAGATEY-----V 478
Query  240  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEY 299
             +  + E LE    V   Q V N     E    GA  T    LR++S D    A      
Sbjct  479  INQDSNERLE---MVKLLQPVNNPGQFREYYAAGAQST-ESYLRVFSND-ILVAALNTPR 533
Query  300  DEDEYEYDEEDRRRG---RGSRGRGNGIEETICTASAKKNIGRNRS--P-------DIYN 347
            D  E  +D++++R G   R S+ +   + +   +A  ++  GR  S  P         Y+
Sbjct  534  DRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAG-QRPWGRRSSGGPISLKSQRSSYS 592
Query  348  PQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHV---- 403
             Q G +  A       L+ +     Y  + R A+ V HYN+ A  ++Y + G        
Sbjct  593  NQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMAC 652
Query  404  ------QVVDSNGNRVYDEE-------------LQEGHVLVVPQNFAVA-GKSQSENFEY 443
                  Q  +  G R  +EE             L  G ++V+P    +A   SQ+EN+  
Sbjct  653  PHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRL 712
Query  444  VAFKTDSRPSIAN-LAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQS 502
            V F  + + +  N LAG+N++I+ L  E    S+ + RE+  ++       +FVP  +QS
Sbjct  713  VGFGINGKNNQRNFLAGQNNIINQLEREAKELSFNMPREEIEEIFERQVESYFVPMERQS 772
Query  503  PR 504
             R
Sbjct  773  RR 774

Sequence Alignment: 39. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 41.8 bits 156,  Expect = 0.0001
 Identities = 125/485 25%, Positives = 221/485 45%, Gaps = 77/485 15%
Query  1    RQQPEENACQFQRLNAQRP-DNRIESEGGYIETWNPNN--QEFE-CAG-VALSRLVLRRN 55
            +QQ  +  C+ +    QR  + R    G  ++  NP +  Q +E C       R    + 
Sbjct  34   QQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQT 93
Query  56   ALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQS------QRPPRRLQ 109
              RR       QE   +Q RG          R  ++P+ Q  R Q       Q P R+ Q
Sbjct  94   LCRRRCEQRRQQEERERQ-RG----------RDRQDPQQQYHRCQRRCQIQEQSPERQRQ 142
Query  110  GEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQF 169
             + + ++Q   +Q   R  E        G        +     + S+   + ++    ++
Sbjct  143  CQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEVKY 202
Query  170  PRRFNLAGNTEQ-EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERA 228
              RF     TE+ E+LR  +  R     + P +   P+ +   E      RG+ +    +
Sbjct  203  LERF-----TERTELLRGIENYRVVILDANPNTSMLPHHKD-AESVAVVTRGRATLTLVS 256
Query  229  GQEEEN---EGGNIF---SGFTPEFLEQAFQ-----VDDRQIVQNLRGETESEEEGAIVT 277
             +  E+   E G++    +G T   + Q        V   Q V N     E    GA   
Sbjct  257  QETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSP 316
Query  278  VRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRG---RGSRGRGNGIEETICTAS-- 332
             +  LR++S D    A      D  E  +D++++R G   R S+ +   + +   +A   
Sbjct  317  DQSYLRVFSND-ILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQR 375
Query  333  --AKKNIG-----RNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAH 385
               +++ G     ++ SP  Y+ Q G +  A       L+ +     Y  + R A+ V H
Sbjct  376  PWGRRSSGGPISLKSESPS-YSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPH 434
Query  386  YNTNAHSIIYRLRGRA-------HV--QVVDSNGNRVYDEE------------LQEGHVL 424
            YN+ A  ++Y + G         HV  Q  +  G R  +EE            L  G ++
Sbjct  435  YNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIF 494
Query  425  VVPQNFAVA-GKSQSENFEYVAFKTDSRPSIAN-LAGENSVIDNLPEEVVANSYGLQREQ 482
            V+P    +A   SQ+EN+  + F  +   +  + LAG+N++I+ L  E    S+ + RE+
Sbjct  495  VIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNMPREE 554
Query  483  ARQLKNNNPFKFFVPPSQQSPR 504
              ++  +    +FVP  +QS R
Sbjct  555  IEEIFESQMESYFVPTERQSRR 576

Sequence Alignment: 40. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 41.6 bits 155,  Expect = 0.0001
 Identities = 72/261 27%, Positives = 121/261 46%, Gaps = 53/261 20%
Query  194  RRRSLPYSPYSPQSQP--RQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQA 251
            R R  P  P     QP  ++E+ +  PR     R +  QEEE+E          +  EQ 
Sbjct  13   RPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHE----------QREEQE 62
Query  252  FQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDR 311
            +   + +     RGE  SEEE          R +   R     EE + +EDE   DEE +
Sbjct  63   WPRKEEK-----RGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERKQEEDE---DEEQQ 114
Query  312  RRGRGSRGRGNGIEETICTASAKKN---IGRNRSPDIYNPQAGSLKTANDLNLLILRWLG 368
            R    S       E++       KN    G NR   ++  Q G ++    +N        
Sbjct  115  RESEES-------EDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFN-----QRS 162
Query  369  PSAEYGNLYRNALFVAHYNT-------NAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEG 421
            P  +    YR   F +  NT       +A  +I  L G A + +V+++    Y   LQ G
Sbjct  163  PQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSY--RLQSG 220
Query  422  HVLVVPQN--FAVAGKSQSENFEYVAFKTD-SRPS------IANLAGENSVIDNLPEEVV 472
              L VP    + V     +EN+  + +    ++P       +++   + S +  +   ++
Sbjct  221  DALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNIL 280
Query  473  ANSYGLQREQARQL 486
              SY  + E+  ++
Sbjct  281  EASYDTKFEEINKV 294

Sequence Alignment: 41. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 41.1 bits 153,  Expect = 0.0002
 Identities = 82/316 25%, Positives = 151/316 47%, Gaps = 60/316 18%
Query  133  IAVPTGVAFWLY-NDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSR 191
            ++V  G+A+W   N      +    ++ ++  NQ      R NL    ++E     ++  
Sbjct  19   VSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQ--ACHARCNLLKVEKEEC----EEGE 72
Query  192  QSRRRSLPYSPYSPQSQP--RQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLE 249
              R R  P  P     QP  ++E+ +  PR     R +  QEEE+E          +  E
Sbjct  73   IPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHE----------QREE 122
Query  250  QAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILS----PDRKRRADEEEEYDEDEYE 305
            Q +   + +     RGE  SEEE          R +     P +K   +EEE+ DE++  
Sbjct  123  QEWPRKEEK-----RGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQR 177
Query  306  YDEED------RRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDL 359
              EE       R + +     G+   ET+     K   GR R    +N ++  L+   D 
Sbjct  178  ESEESEDSELRRHKNKNPFLFGSNRFETLF----KNQYGRIRVLQRFNQRSPQLQNLRDY 233
Query  360  NLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQ 419
             +L         E+ N   N L++ ++  +A  +I  L G A + +V+++    Y   LQ
Sbjct  234  RIL---------EF-NSKPNTLLLPNH-ADADYLIVILNGTAILSLVNNDDRDSY--RLQ 280
Query  420  EGHVLVVPQN--FAVAGKSQSENFEYVAFKTD-SRPS------IANLAGENSVIDNLPEE 470
             G  L VP    + V     +EN+  + +    ++P       +++   + S +  +   
Sbjct  281  SGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRN 340
Query  471  VVANSYGLQREQARQL 486
            ++  SY  + E+  ++
Sbjct  341  ILEASYDTKFEEINKV 356

Sequence Alignment: 42. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 35.8 bits 130,  Expect = 0.009
 Identities = 104/445 23%, Positives = 196/445 44%, Gaps = 76/445 17%
Query  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
            +Q EE   ++Q    +      E E    +     ++E + +  + S+   RR+  + PF
Sbjct  153  HQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPF 212
Query  62   YSNAP--QEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 119
            + N+   Q +F  Q    +G +     R  +  + + ++ Q+ R  R L+   +     +
Sbjct  213  HFNSKRFQTLFKNQ----YGHV-----RVLQRFNKRSQQLQNLRDYRILEFNSKP----N 259
Query  120  SHQKVHRFDEGDLIAVPTGVAFW-LYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN 178
            +    H  D   LI +  G A   L N+ D D   +   D         + P     AG 
Sbjct  260  TLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDAL-------RVP-----AGT 307
Query  179  TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFS---PRGQHSRRERAGQEEENE 235
            T   F      + ++ R     + Y       +  R  +   P  +  R E         
Sbjct  308  T---FYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQA 364
Query  236  GGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADE 295
              + + GF+   LE ++     +I + L G  E +++G                + R  E
Sbjct  365  QQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQG----------------EERLQE 408
Query  296  EEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKT 355
                +  + +  E  +     SR       +TI +     N+G +R P IY+ + G L  
Sbjct  409  SVIVEISKKQIRELSKHAKSSSR-------KTISSEDKPFNLG-SRDP-IYSNKLGKLFE 459
Query  356  ANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGN---- 411
                N   LR L       ++   ALF+ H+N+ A  ++    G A++++V         
Sbjct  460  ITQRNPQ-LRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQ 518
Query  412  ---------RVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN-LAG-E 460
                     R Y  EL E  ++V+P  + V   + S+ + + AF  ++  +  N LAG +
Sbjct  519  QQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD-LNFFAFGINAENNQRNFLAGSK 577
Query  461  NSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQ 501
            ++VI  +P +V   ++    +    L  +    +FV    Q
Sbjct  578  DNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQ 618

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.