The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

RVVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP
MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA07773 Ory s TAI 109 800 121.1 6.6e-30
BAA01998 Ory s TAI 165 735 112.4 4.1e-27
BAA02000 Ory s TAI 166 732 112.0 5.5e-27
BAA07711 Ory s TAI 160 720 110.3 1.7e-26
BAA07710 Ory s TAI 166 720 110.4 1.8e-26
BAA07772 Ory s TAI 111 708 108.4 4.5e-26
BAA07774 Ory s TAI 113 705 108.0 6.1e-26
BAA01997 Ory s TAI 162 663 102.5 4.1e-24
BAA07713 Ory s TAI 160 582 91.2 9.7e-21
BAA01996 Ory s TAI 157 570 89.6 3e-20
BAA07712 Ory s TAI 157 527 83.6 1.9e-18
AAB99797 Ory s TAI 157 403 66.5 2.7e-13
P16968 Hor v 1 146 376 62.7 3.5e-12
P16968 Hor v 15.0101 146 376 62.7 3.5e-12
CBA13560 Tri a 15.0101 121 293 51.1 9.2e-09
P01083 Tri a TAI 123 291 50.8 1.1e-08
CAA08836 Hor v 1 152 289 50.7 1.5e-08
BAA01999 Ory s TAI 95 208 39.1 2.8e-05
CAI84642 Tri a 28.0101 119 199 38.0 7.5e-05
P01085 Tri a TAI 124 199 38.1 7.7e-05
P01084 Tri a TAI 124 186 36.3 0.00027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 121.1 bits 800,  Expect = 7e-30
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    RVVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 60
            RVVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP
Sbjct  1    RVVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 60
Query  61   MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109
            MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  61   MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 112.4 bits 735,  Expect = 4e-27
 Identities = 99/108 91%, Positives = 101/108 93%, Gaps = 0/108 0%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            VVKRQCV TR  G  DEQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM
Sbjct  58   VVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 117
Query  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109
            AEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  118  AEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 112.0 bits 732,  Expect = 6e-27
 Identities = 101/108 93%, Positives = 102/108 94%, Gaps = 1/108 0%
Query  2    VVKRQCVATRRTGGA-DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 60
            VVKRQCV     GGA DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP
Sbjct  58   VVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 117
Query  61   MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109
            MAEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  118  MAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 110.3 bits 720,  Expect = 2e-26
 Identities = 101/108 93%, Positives = 102/108 94%, Gaps = 2/108 1%
Query  2    VVKRQCVATRRTGGA-DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 60
            VVKRQCV     GGA DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP
Sbjct  51   VVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 110
Query  61   MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 109
            MAEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  111  MAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 110.4 bits 720,  Expect = 2e-26
 Identities = 99/108 91%, Positives = 101/108 93%, Gaps = 1/108 0%
Query  2    VVKRQCVATRRTGG-ADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 60
            VVKRQCVAT       +EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP
Sbjct  58   VVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 117
Query  61   MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109
            MAEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  118  MAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 108.4 bits 708,  Expect = 5e-26
 Identities = 97/107 90%, Positives = 98/107 91%, Gaps = 1/107 0%
Query  3    VKRQCVATRRTGG-ADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            VKRQCVAT        EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM
Sbjct  4    VKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 63
Query  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109
            AEVFPGCRRGDLER R +LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  64   AEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 108.0 bits 705,  Expect = 6e-26
 Identities = 97/109 88%, Positives = 100/109 91%, Gaps = 1/109 0%
Query  1    RVVKRQCVATRRTGGA-DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH 59
            R  +RQCV  RRT     +QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH
Sbjct  4    RFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH 63
Query  60   PMAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109
            PMAEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  64   PMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 102.5 bits 663,  Expect = 4e-24
 Identities = 88/107 82%, Positives = 95/107 88%, Gaps = 1/107 0%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            +V+RQCV  R    ADEQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPM
Sbjct  56   LVRRQCVG-RGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPM 114
Query  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109
            AEVFPGCRRGDLERA A+LPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  115  AEVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 91.2 bits 582,  Expect = 1e-20
 Identities = 79/97 81%, Positives = 87/97 89%, Gaps = 1/97 1%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            +VKRQCV  R T  A EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM
Sbjct  59   LVKRQCVG-RGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPM 117
Query  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWL 99
            +EVF GCRRGDLERA A+LPAFCNVDIPNG GGVCYWL
Sbjct  118  SEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 89.6 bits 570,  Expect = 3e-20
 Identities = 77/95 81%, Positives = 86/95 90%, Gaps = 3/95 3%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            +VKRQC   R +  A EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM
Sbjct  58   LVKRQC---RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPM 114
Query  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWL 99
            +EVF GCRRGDLERA A+LPAFCNVDIPNG GGVCYWL
Sbjct  115  SEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 83.6 bits 527,  Expect = 2e-18
 Identities = 75/99 75%, Positives = 82/99 82%, Gaps = 8/99 8%
Query  3    VKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 62
            VKRQCVA    G  DEQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHPMA
Sbjct  59   VKRQCVAP---GTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMA 115
Query  63   EVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109
            EVF GCRRGD+ERA A+LPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  116  EVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 66.5 bits 403,  Expect = 3e-13
 Identities = 54/76 71%, Positives = 59/76 77%, Gaps = 1/76 1%
Query  23   DCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERARATLPA 82
            DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRG    AR   P 
Sbjct  77   DCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPG 135
Query  83   FCNVDIPNGTGGVCYWL 99
               VDIPNG GGVCYWL
Sbjct  136  VLQVDIPNGGGGVCYWL 152

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 62.7 bits 376,  Expect = 4e-12
 Identities = 56/101 55%, Positives = 69/101 68%, Gaps = 8/101 7%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGAT--DVGH 59
            +VK QC      G   E +++DCCRQ+AA+ D WC C AL  M G +Y+ELG    D   
Sbjct  37   LVKSQCAG----GQVVESIQKDCCRQIAAIGDEWCICGALGSMRGSMYKELGVALADDKA 92
Query  60   PMAEVFPGCRRGDLERARATLPAFCNVDIPN--GTGGVCYWLGYPRTPR 106
             +AEVFPGCR   ++RA A+LPA CN  IPN  GT GVCYWL Y + PR
Sbjct  93   TVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 62.7 bits 376,  Expect = 4e-12
 Identities = 56/101 55%, Positives = 69/101 68%, Gaps = 8/101 7%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGAT--DVGH 59
            +VK QC      G   E +++DCCRQ+AA+ D WC C AL  M G +Y+ELG    D   
Sbjct  37   LVKSQCAG----GQVVESIQKDCCRQIAAIGDEWCICGALGSMRGSMYKELGVALADDKA 92
Query  60   PMAEVFPGCRRGDLERARATLPAFCNVDIPN--GTGGVCYWLGYPRTPR 106
             +AEVFPGCR   ++RA A+LPA CN  IPN  GT GVCYWL Y + PR
Sbjct  93   TVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 15. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 51.1 bits 293,  Expect = 9e-09
 Identities = 45/93 48%, Positives = 65/93 69%, Gaps = 11/93 11%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            +VK QCV ++      E + +DCC+QLA V++ WCRC  L+ M+  +Y+ELGA + G   
Sbjct  24   MVKLQCVGSQ----VPEAVLRDCCQQLADVNNEWCRCEDLSSMLRSVYQELGARE-GK-- 76
Query  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTG---GVCYWLGYP 102
             EV+PGCR+  ++   A++P    V IPN +G   GVCYW  YP
Sbjct  77   -EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAAYP 119

Sequence Alignment: 16. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 50.8 bits 291,  Expect = 1e-08
 Identities = 44/93 47%, Positives = 65/93 69%, Gaps = 13/93 13%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            +VK QCV ++      E + +DCC+QLA +++ WCRC  L+ M+  +Y+ELG  + G   
Sbjct  24   MVKLQCVGSQ----VPEAVLRDCCQQLADINNEWCRCGDLSSMLRSVYQELGVRE-GK-- 76
Query  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTG---GVCY--WLGYP 102
             EV+PGCR+  ++   A++P  C V IPN +G   GVCY  W  YP
Sbjct  77   -EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAYP 121

Sequence Alignment: 17. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 50.7 bits 289,  Expect = 2e-08
 Identities = 43/90 47%, Positives = 60/90 66%, Gaps = 10/90 11%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            +VK +CV  R      E + +DCC+++A + + WCRC  L  M+  +Y  LG   VG   
Sbjct  54   LVKLECVGNR----VPEDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALG---VGGGP 106
Query  62   AEVFPGCRRGDLERARATLPAFCNVDIPN---GTGGVCYW 98
             EVFPGC++  ++   A +PA+CNV IPN   GT GVCYW
Sbjct  107  EEVFPGCQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYW 146

Sequence Alignment: 18. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 39.1 bits 208,  Expect = 3e-05
 Identities = 28/40 70%, Positives = 32/40 80%, Gaps = 1/40 2%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALN 42
            +V+RQCV  R    ADEQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  56   LVRRQCVG-RGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 19. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 38.0 bits 199,  Expect = 8e-05
 Identities = 34/89 38%, Positives = 55/89 61%, Gaps = 10/89 11%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            +++ QC  ++      E + +DCC+QLA + + WCRC AL  M+  +Y+E GA + G+  
Sbjct  18   LLRLQCNGSQ----VPEAVLRDCCQQLAHISE-WCRCGALYSMLDSMYKEHGAQE-GQAG 71
Query  62   AEVFPGCRRGDLERARATLPAFCNVDI---PNGTGG-VC 96
               FP CRR  ++   A++ A C + I    +G G  VC
Sbjct  72   TGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 38.1 bits 199,  Expect = 8e-05
 Identities = 34/89 38%, Positives = 55/89 61%, Gaps = 10/89 11%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            +++ QC  ++      E + +DCC+QLA + + WCRC AL  M+  +Y+E GA + G+  
Sbjct  23   LLRLQCNGSQ----VPEAVLRDCCQQLAHISE-WCRCGALYSMLDSMYKEHGAQE-GQAG 76
Query  62   AEVFPGCRRGDLERARATLPAFCNVDI---PNGTGG-VC 96
               FP CRR  ++   A++ A C + I    +G G  VC
Sbjct  77   TGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 36.3 bits 186,  Expect = 0.0003
 Identities = 33/89 37%, Positives = 54/89 60%, Gaps = 10/89 11%
Query  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
            ++K QC  ++      E + +DCC+QLA + + W RC AL  M+  +Y+E G ++ G+  
Sbjct  23   LLKLQCNGSQ----VPEAVLRDCCQQLADISE-WPRCGALYSMLDSMYKEHGVSE-GQAG 76
Query  62   AEVFPGCRRGDLERARATLPAFCNVDI---PNGTGG-VC 96
               FP CRR  ++   A++ A C + I    +G G  VC
Sbjct  77   TGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.