The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SFAGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEED
ELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ
Sequence Info Allergen Name Length Opt Bits Score E Value
P86432 Onc m 1.0201 107 579 139.7 1.6e-35
Q91483 Sal s 1 107 515 125.1 4e-31
CAA66404 Sal s 1 108 515 125.1 4.1e-31
QCY53440 Cten i 1.0101 109 483 117.8 6.5e-29
CAC83658 Cyp c 1.01 109 471 115.1 4.3e-28
Q5IRB2 Lat c 1.0101 109 469 114.6 5.9e-28
CAC83659 Cyp c 1.02 109 466 113.9 9.5e-28
CAQ72971 Clu h 1.0201 110 461 112.8 2.1e-27
CAQ72967 Thu a 1.0101 109 454 111.2 6.3e-27
AAK63087 Gad m 1.0201 109 446 109.4 2.2e-26
Q90YK9 Gad m 1.0201 109 446 109.4 2.2e-26
XP_026772003 Pan h 1.0101 109 444 108.9 3.1e-26
CAM56786 Gad m 1.0202 109 435 106.9 1.3e-25
CAQ72970 Clu h 1.0101 109 435 106.9 1.3e-25
AAK63086 Gad m 1.0101 109 434 106.6 1.5e-25
CAQ72968 Seb m 1.0101 109 432 106.2 2e-25
CAM56785 Gad m 1.0102 109 428 105.3 3.9e-25
CAQ72972 Clu h 1.0301 109 414 102.1 3.5e-24
Q90YK7 The c 1 109 412 101.6 4.8e-24
FM177701 Sar sa 1.0101 109 404 99.8 1.7e-23
FM202668 Xip g 1.0101 109 403 99.6 2e-23
P59747 Sco j 1 109 401 99.1 2.7e-23
XP_019397705 Cro p 1.0101 109 398 98.4 4.4e-23
Q91482 Sal s 1 109 396 98.0 6.1e-23
P86431 Onc m 1.0101 108 394 97.5 8.2e-23
AM904681 Lep w 1.0101 109 393 97.3 9.7e-23
CAQ72969 Seb m 1.0201 110 392 97.1 1.2e-22
A0A1B1V0G7 Ras k 1.0101 109 391 96.8 1.3e-22
Q6ITU9 Lat c 1.0201 109 384 95.2 4e-22
P02622 Gad c 1 113 352 87.9 6.7e-20
CAC95152 Ran e 2 109 347 86.8 1.4e-19
XP_019400389 Cro p 2.0101 110 334 83.8 1.1e-18
C1L370 Gal d 8.0101 110 323 81.3 6.3e-18
XP_026803769 Pan h 1.0201 109 296 75.2 4.4e-16
CAC83046 Ran e 1 110 295 75.0 5.2e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 139.7 bits 579,  Expect = 2e-35
 Identities = 107/107 100%, Positives = 93/107 86%, Gaps = 0/107 0%
Query  1    SFAGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEED 60
            SFAGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEED
Sbjct  1    SFAGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEED 60
Query  61   ELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
            ELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ
Sbjct  61   ELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107

Sequence Alignment: 2. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 125.1 bits 515,  Expect = 4e-31
 Identities = 80/106 75%, Positives = 87/106 82%, Gaps = 0/106 0%
Query  1    SFAGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEED 60
            SFAGLNDADVAAALAAC AADSFNHKAFFAK      S DD+KK    +DQDKSGF+EED
Sbjct  1    SFAGLNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEED 60
Query  61   ELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            ELKLFLQNFSASARALTDAETK     GD DGDGM+G+DEFA ++K
Sbjct  61   ELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 3. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 125.1 bits 515,  Expect = 4e-31
 Identities = 80/106 75%, Positives = 87/106 82%, Gaps = 0/106 0%
Query  1    SFAGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEED 60
            SFAGLNDADVAAALAAC AADSFNHKAFFAK      S DD+KK    +DQDKSGF+EED
Sbjct  2    SFAGLNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEED 61
Query  61   ELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            ELKLFLQNFSASARALTDAETK     GD DGDGM+G+DEFA ++K
Sbjct  62   ELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 4. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 117.8 bits 483,  Expect = 6e-29
 Identities = 77/106 72%, Positives = 85/106 80%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG LNDAD+AAAL AC AADSFNHKAFFAK      S DD+KK    +DQDKSGF+EE
Sbjct  2    AFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNF A ARALTDAETK    AGD+DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 5. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 115.1 bits 471,  Expect = 4e-28
 Identities = 73/106 68%, Positives = 85/106 80%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG LNDAD+ AAL  C AADSF++K+FFAK      +PDD+KK    +DQDKSGF+EE
Sbjct  2    AFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNFSA ARALTDAETK    AGD+DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 6. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 114.6 bits 469,  Expect = 6e-28
 Identities = 75/106 70%, Positives = 84/106 79%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG LN+AD+ AALAAC AADSF HK FF K      S DD+KK    +DQDKSGF+EE
Sbjct  2    AFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNFSASARALTDAETK    AGD+DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 7. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 113.9 bits 466,  Expect = 1e-27
 Identities = 73/106 68%, Positives = 81/106 76%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG LNDAD+ AAL AC AADSFNHK FFAK      S DD+KK    +DQDKSGF+EE
Sbjct  2    AFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNF A ARALTD ETK    AGD+DGDG +G+DEF  LVK
Sbjct  62   DELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVK 108

Sequence Alignment: 8. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 112.8 bits 461,  Expect = 2e-27
 Identities = 71/106 66%, Positives = 85/106 80%, Gaps = 1/106 0%
Query  1    SFAGL-NDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAGL +DAD+AAAL AC AAD+F+HK+FF K      S DD+KK    +DQDKSGF+EE
Sbjct  2    AFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            +ELKLFLQNF A ARAL+D ETK    AGDADGDGM+G+DEFAV+VK
Sbjct  62   EELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108

Sequence Alignment: 9. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 111.2 bits 454,  Expect = 6e-27
 Identities = 71/106 66%, Positives = 83/106 78%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG L +AD+ AALAAC AADSF +K FF K      +P+D+KK    +DQDKSGF+EE
Sbjct  2    AFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNFSA ARALTDAETK    AGD+DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108

Sequence Alignment: 10. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 109.4 bits 446,  Expect = 2e-26
 Identities = 69/106 65%, Positives = 81/106 76%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG LNDAD+ AALAAC A  SF+HKAFF K      SP D+KK    +DQDKS F+EE
Sbjct  2    AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNFSA ARAL+DAETK    AGD+DGDG +G+DEF  ++K
Sbjct  62   DELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 11. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 109.4 bits 446,  Expect = 2e-26
 Identities = 69/106 65%, Positives = 81/106 76%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG LNDAD+ AALAAC A  SF+HKAFF K      SP D+KK    +DQDKS F+EE
Sbjct  2    AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNFSA ARAL+DAETK    AGD+DGDG +G+DEF  ++K
Sbjct  62   DELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 12. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 108.9 bits 444,  Expect = 3e-26
 Identities = 71/106 66%, Positives = 80/106 75%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG LNDAD+AAAL AC A  SF+HKAFF K      S DD+KK    +DQDKSGF+EE
Sbjct  2    AFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNF + ARALTD ETK    AGD DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVK 108

Sequence Alignment: 13. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 106.9 bits 435,  Expect = 1e-25
 Identities = 68/106 64%, Positives = 80/106 75%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG LNDAD+ AALAAC A  SF+HKAFF K      S  D+KK    +DQDKS F+EE
Sbjct  2    AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQNFSA ARAL+DAETK    AGD+DGDG +G+DEF  ++K
Sbjct  62   DELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 14. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 106.9 bits 435,  Expect = 1e-25
 Identities = 68/102 66%, Positives = 76/102 74%, Gaps = 0/102 0%
Query  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
            L  AD+ AAL AC A DSF HK FFAK      S  DLKK    +DQDKSGF+EE+ELKL
Sbjct  7    LKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIEEEELKL 66
Query  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            FLQNF A ARALTDAETK    AGDADGDGM+G+DEFAV++K
Sbjct  67   FLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 15. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 106.6 bits 434,  Expect = 1e-25
 Identities = 71/106 66%, Positives = 83/106 78%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG L DAD AAA+ AC AA+SF++KAFFAK      S DD+KK    +DQDKSGF+EE
Sbjct  2    AFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQ F A ARALTDAETK    AGD+DGDG +G+DE+AVLVK
Sbjct  62   DELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108

Sequence Alignment: 16. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 106.2 bits 432,  Expect = 2e-25
 Identities = 65/104 62%, Positives = 78/104 75%, Gaps = 0/104 0%
Query  3    AGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDEL 62
            A LN AD+ AALAAC+  D+F HK FF K      S DD+K     +DQDKSGF+EE+EL
Sbjct  5    ASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIEEEEL 64
Query  63   KLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            KLFLQNFSA+ARALT+AET     AGD+DGDGM+G+DEFA +VK
Sbjct  65   KLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 17. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 105.3 bits 428,  Expect = 4e-25
 Identities = 70/106 66%, Positives = 83/106 78%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG L DAD AAA+ AC AA+SF++KAFFAK      S DD+KK    +DQDKSGF+EE
Sbjct  2    AFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            DELKLFLQ F A ARALTDAETK    AGD+DGDG +G++E+AVLVK
Sbjct  62   DELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVK 108

Sequence Alignment: 18. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 102.1 bits 414,  Expect = 4e-24
 Identities = 65/107 60%, Positives = 78/107 72%, Gaps = 1/107 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FA  L +AD+ AAL AC  ADSF+HKAFFAK      S D+LKK    +DQDKSGF+EE
Sbjct  2    AFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
            +ELKLFLQNF   ARALTD ETK    AGD+D DG +G+DEFA L+ +
Sbjct  62   EELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALINH 109

Sequence Alignment: 19. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 101.6 bits 412,  Expect = 5e-24
 Identities = 66/106 62%, Positives = 80/106 75%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG L DA+VAAAL AC +A SF+H  FF        S DD+KK    +DQD+S F+EE
Sbjct  2    AFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            +ELKLFLQNFSASARAL+DAETK    AGD+DGDG +G+DEFA +VK
Sbjct  62   EELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108

Sequence Alignment: 20. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 99.8 bits 404,  Expect = 2e-23
 Identities = 66/107 61%, Positives = 78/107 72%, Gaps = 1/107 0%
Query  1    SFAGL-NDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            ++AGL  +AD+ AAL AC AADSF+HKAFF K      S D+LKK    +DQDKSGF+EE
Sbjct  2    ALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
            +ELKLFLQNF   ARALTD ETK    AGD  GDG +G+DEF  LVK+
Sbjct  62   EELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVKH 109

Sequence Alignment: 21. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 99.6 bits 403,  Expect = 2e-23
 Identities = 65/105 61%, Positives = 78/105 74%, Gaps = 1/105 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FAG L+DADVAAAL AC  A +F++K FF        S DD+KK    +DQDKSGF+EE
Sbjct  2    AFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLV 105
            DELKLFLQNF A+AR LTDAET+    AGD+DGDG +G +EFA LV
Sbjct  62   DELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALV 107

Sequence Alignment: 22. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 99.1 bits 401,  Expect = 3e-23
 Identities = 63/106 59%, Positives = 77/106 72%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FA  L DA+V AAL  C AA SF+HK FF        S D++KK    +DQDKSGF+EE
Sbjct  2    AFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            +ELKLFLQNF A ARAL+DAETK    AGD+DGDG +G+DEFA ++K
Sbjct  62   EELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 23. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 98.4 bits 398,  Expect = 4e-23
 Identities = 62/102 60%, Positives = 77/102 75%, Gaps = 0/102 0%
Query  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
            L+  D+ AAL++C AA+SFN+K+FF+       S D +KK    LDQDKSGF+EEDEL+L
Sbjct  7    LSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEEDELQL 66
Query  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            FL+NFS+SARALTDAETK    AGD DGDG +G+DEF  LVK
Sbjct  67   FLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108

Sequence Alignment: 24. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 98.0 bits 396,  Expect = 6e-23
 Identities = 62/101 61%, Positives = 72/101 71%, Gaps = 0/101 0%
Query  7    DADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKLFL 66
            +AD+  AL AC AAD+F+ K FF        S DD+KK    +DQD SGF+E +ELKLFL
Sbjct  9    EADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFL 68
Query  67   QNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
            QNF   AR LTDAETK    AGDADGDGM+G+DEFAVLVKQ
Sbjct  69   QNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ 109

Sequence Alignment: 25. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 97.5 bits 394,  Expect = 8e-23
 Identities = 68/101 67%, Positives = 69/101 68%, Gaps = 0/101 0%
Query  7    DADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKLFL 66
            +AD+  AL AC AADSFN K FF          DD+KKXXX LDQD SGFLE +ELKLFL
Sbjct  8    EADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFL 67
Query  67   QNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
            QNF      LTDAETK    AGDADGDGMLGLDEFAVLVKQ
Sbjct  68   QNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108

Sequence Alignment: 26. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 97.3 bits 393,  Expect = 1e-22
 Identities = 61/106 57%, Positives = 77/106 72%, Gaps = 0/106 0%
Query  1    SFAGLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEED 60
            +FAGL+ A++ AAL  CAAADSF++K FF        S +++K     +DQD+SGF+EED
Sbjct  2    TFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEED 61
Query  61   ELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            ELKLFLQNFSASARALTD ET     AGD DGDG +G++EF  LV+
Sbjct  62   ELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107

Sequence Alignment: 27. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 97.1 bits 392,  Expect = 1e-22
 Identities = 61/104 58%, Positives = 72/104 69%, Gaps = 0/104 0%
Query  4    GLNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELK 63
            GL DAD+AAAL  C  A  FNHK FF        S D++KK    +DQD SGF+EE+ELK
Sbjct  7    GLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFIEEEELK 66
Query  64   LFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
            LFLQ F A ARAL+DAETK    AGD+DGDG +G DE+A +VKQ
Sbjct  67   LFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVKQ 110

Sequence Alignment: 28. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 96.8 bits 391,  Expect = 1e-22
 Identities = 61/106 57%, Positives = 74/106 69%, Gaps = 1/106 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +FA  L DA++ AAL  C A  SF+HK FF        S DD+KK    +DQDKSGF+EE
Sbjct  2    AFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIEE 61
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            +ELKLFLQNF A AR L+DAETK    AGD DGDG +G+DEFA ++K
Sbjct  62   EELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 29. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 95.2 bits 384,  Expect = 4e-22
 Identities = 59/102 57%, Positives = 70/102 68%, Gaps = 0/102 0%
Query  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
            L+D+DVAAAL  C  A +F+HK FF+       + DD+KK    +DQDKSGF+EE+ELKL
Sbjct  7    LSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIEEEELKL 66
Query  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            FLQNF A AR LTD ET     AGD DGDG +G DEF  LVK
Sbjct  67   FLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 30. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 87.9 bits 352,  Expect = 7e-20
 Identities = 58/107 54%, Positives = 72/107 67%, Gaps = 1/107 0%
Query  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
            +F G L++AD+ AA AAC    SF+   F+AK      S D+LKK     D+DK GF+EE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
            DELKLFL  F+A  RALTDAETK    AGD+DGDG +G+DEF  LV +
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDK 108

Sequence Alignment: 31. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 86.8 bits 347,  Expect = 1e-19
 Identities = 56/102 54%, Positives = 70/102 68%, Gaps = 0/102 0%
Query  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
            +++ D+ AAL +  AA SFN+K FF K      S  D KK    LD+DKSGF+E+DEL L
Sbjct  7    VSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIEQDELGL 66
Query  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106
            FLQNF ASAR L+DAET     AGD+DGDG +G++EF  LVK
Sbjct  67   FLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVK 108

Sequence Alignment: 32. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 83.8 bits 334,  Expect = 1e-18
 Identities = 53/103 51%, Positives = 67/103 65%, Gaps = 0/103 0%
Query  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
            L+  D+  A+ A AAA+SFNHK FF        S DD+KK    LD+D+SGF+EEDELK 
Sbjct  7    LSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIEEDELKS 66
Query  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
             L+ F+  AR L+D ETK    AGD DGDG +G+DEF  LV +
Sbjct  67   VLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLVAE 109

Sequence Alignment: 33. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 81.3 bits 323,  Expect = 6e-18
 Identities = 49/103 47%, Positives = 68/103 66%, Gaps = 0/103 0%
Query  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
            L+  D+  A+ A +AA+SFN+K FF        SP+D+KK    LD+D+SGF+EE+ELK+
Sbjct  7    LSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIEEEELKF 66
Query  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
             L+ F+   R L+D ETK    AGD DGDG +G DEFA +V +
Sbjct  67   VLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMVAE 109

Sequence Alignment: 34. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 75.2 bits 296,  Expect = 4e-16
 Identities = 48/103 46%, Positives = 60/103 58%, Gaps = 0/103 0%
Query  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
            L   D+  AL     AD+F+HK FF        S +++KK    LD D SGF+EEDELK+
Sbjct  7    LKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIEEDELKF 66
Query  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
             L+ FS   R LTD ETK    A D DGDG +G+DEF  +V Q
Sbjct  67   VLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIVHQ 109

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 75.0 bits 295,  Expect = 5e-16
 Identities = 46/103 44%, Positives = 65/103 63%, Gaps = 0/103 0%
Query  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
            L   D++ A++A AA +SFNHK FF        S + ++K    LDQD+SGF+E++EL L
Sbjct  7    LAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIEKEELCL 66
Query  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107
             L+ F+   R+L+D ET     AGD DGDG +G+DEF  LV +
Sbjct  67   ILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLVSE 109

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.