The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS
SMLRSVYQELGVREGKEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAY
PDV
Sequence Info Allergen Name Length Opt Bits Score E Value
P01083 Tri a TAI 123 894 120.2 1.7e-29
CBA13560 Tri a 15.0101 121 825 111.7 5.7e-27
CAA08836 Hor v 1 152 590 83.1 2.9e-18
P01084 Tri a TAI 124 504 72.5 3.7e-15
P01085 Tri a TAI 124 495 71.4 8e-15
CAI84642 Tri a 28.0101 119 470 68.3 6.5e-14
P16968 Hor v 1 146 418 62.1 6e-12
P16968 Hor v 15.0101 146 418 62.1 6e-12
BAA01997 Ory s TAI 162 383 57.9 1.2e-10
BAA01998 Ory s TAI 165 378 57.3 1.9e-10
BAA02000 Ory s TAI 166 375 56.9 2.4e-10
BAA07710 Ory s TAI 166 367 55.9 4.8e-10
BAA07711 Ory s TAI 160 365 55.7 5.6e-10
BAA07713 Ory s TAI 160 357 54.7 1.1e-09
BAA01996 Ory s TAI 157 355 54.4 1.3e-09
BAA07712 Ory s TAI 157 327 51.0 1.4e-08
BAA07773 Ory s TAI 109 291 46.4 2.4e-07
BAA07772 Ory s TAI 111 291 46.4 2.4e-07
BAA07774 Ory s TAI 113 288 46.0 3.1e-07
P10846 Tri a TAI 44 226 37.9 3.5e-05
AAB99797 Ory s TAI 157 222 38.2 0.0001
BAA01999 Ory s TAI 95 205 35.8 0.00032
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 120.2 bits 894,  Expect = 2e-29
 Identities = 123/123 100%, Positives = 123/123 100%, Gaps = 0/123 0%
Query  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
            SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS
Sbjct  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
Query  61   SMLRSVYQELGVREGKEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAY 120
            SMLRSVYQELGVREGKEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAY
Sbjct  61   SMLRSVYQELGVREGKEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAY 120
Query  121  PDV 123
            PDV
Sbjct  121  PDV 123

Sequence Alignment: 2. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 111.7 bits 825,  Expect = 6e-27
 Identities = 116/121 95%, Positives = 118/121 97%, Gaps = 2/121 1%
Query  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
            SGPWSWC+PATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLAD+NNEWCRC DLS
Sbjct  1    SGPWSWCDPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADVNNEWCRCEDLS 60
Query  61   SMLRSVYQELGVREGKEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAY 120
            SMLRSVYQELG REGKEVLPGCRKEVMKLTAASVPEV KVPIPNPSGDRAGVCY  WAAY
Sbjct  61   SMLRSVYQELGAREGKEVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCY--WAAY 118
Query  121  PDV 123
            PDV
Sbjct  119  PDV 121

Sequence Alignment: 3. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 83.1 bits 590,  Expect = 3e-18
 Identities = 80/120 66%, Positives = 97/120 80%, Gaps = 3/120 2%
Query  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
            SGPW WC+P  G+KVS LT CRA+VKL+CVG++VPE VLRDCCQ++A+I+NEWCRCGDL 
Sbjct  31   SGPWMWCDPEMGHKVSPLTRCRALVKLECVGNRVPEDVLRDCCQEVANISNEWCRCGDLG 90
Query  61   SMLRSVYQELGVREG-KEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAA 119
            SMLRSVY  LGV  G +EV+PGC+K+VMKL  A VP +C VPIPN +    GVCY  W+A
Sbjct  91   SMLRSVYAALGVGGGPEEVFPGCQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCY--WSA 148
Query  120  YPD 122
              D
Sbjct  149  STD 151

Sequence Alignment: 4. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 72.5 bits 504,  Expect = 4e-15
 Identities = 78/119 65%, Positives = 93/119 78%, Gaps = 7/119 5%
Query  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
            SGPW  C P   ++V AL GCR ++KLQC GSQVPEAVLRDCCQQLADI+ EW RCG L 
Sbjct  1    SGPW-MCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADIS-EWPRCGALY 58
Query  61   SMLRSVYQELGVREGKE---VLPGCRKEVMKLTAASVPEVCKVPIP-NPSGDRAGVCYGD 116
            SML S+Y+E GV EG+     +P CR+EV+KLTAAS+  VC++PI  + SGD A VC  D
Sbjct  59   SMLDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCK-D 117
Query  117  WAAYPD 122
             AAYPD
Sbjct  118  VAAYPD 123

Sequence Alignment: 5. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 71.4 bits 495,  Expect = 8e-15
 Identities = 75/119 63%, Positives = 92/119 77%, Gaps = 7/119 5%
Query  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
            SGPW  C P   ++V AL  CR +++LQC GSQVPEAVLRDCCQQLA I+ EWCRCG L 
Sbjct  1    SGPW-MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHIS-EWCRCGALY 58
Query  61   SMLRSVYQELGVREGKE---VLPGCRKEVMKLTAASVPEVCKVPIP-NPSGDRAGVCYGD 116
            SML S+Y+E G +EG+     +P CR+EV+KLTAAS+  VC++PI  + SGD A VC  D
Sbjct  59   SMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCK-D 117
Query  117  WAAYPD 122
             AAYPD
Sbjct  118  VAAYPD 123

Sequence Alignment: 6. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 68.3 bits 470,  Expect = 6e-14
 Identities = 71/114 62%, Positives = 88/114 77%, Gaps = 6/114 5%
Query  7    CNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLSSMLRSV 66
            C P   ++V AL  CR +++LQC GSQVPEAVLRDCCQQLA I+ EWCRCG L SML S+
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHIS-EWCRCGALYSMLDSM 59
Query  67   YQELGVREGKE---VLPGCRKEVMKLTAASVPEVCKVPIP-NPSGDRAGVCYGDWAAYPD 122
            Y+E G +EG+     +P CR+EV+KLTAAS+  VC++PI  + SGD A VC  D AAYPD
Sbjct  60   YKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCK-DVAAYPD 118

Sequence Alignment: 7. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 62.1 bits 418,  Expect = 6e-12
 Identities = 63/117 53%, Positives = 79/117 67%, Gaps = 9/117 7%
Query  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
            + P  WC P  GY V  +  CRA+VK QC G QV E++ +DCC+Q+A I +EWC CG L 
Sbjct  14   NSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIAAIGDEWCICGALG 73
Query  61   SMLRSVYQELGVR--EGK----EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCY 114
            SM  S+Y+ELGV   + K    EV+PGCR EVM    AS+P VC   IPN +G   GVCY
Sbjct  74   SMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTD-GVCY 132
Query  115  GDWAAY 120
              W +Y
Sbjct  133  --WLSY 136

Sequence Alignment: 8. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 62.1 bits 418,  Expect = 6e-12
 Identities = 63/117 53%, Positives = 79/117 67%, Gaps = 9/117 7%
Query  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
            + P  WC P  GY V  +  CRA+VK QC G QV E++ +DCC+Q+A I +EWC CG L 
Sbjct  14   NSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIAAIGDEWCICGALG 73
Query  61   SMLRSVYQELGVR--EGK----EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCY 114
            SM  S+Y+ELGV   + K    EV+PGCR EVM    AS+P VC   IPN +G   GVCY
Sbjct  74   SMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTD-GVCY 132
Query  115  GDWAAY 120
              W +Y
Sbjct  133  --WLSY 136

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 57.9 bits 383,  Expect = 1e-10
 Identities = 57/114 50%, Positives = 72/114 63%, Gaps = 12/114 10%
Query  3    PWSWCNPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADINNEWCRCGDL 59
            P   C P   Y   +L  CR +V+ QCVG   S   E V +DCC+QLA +++ WCRCG L
Sbjct  35   PGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
Query  60   SSMLRSVYQELGVREG----KEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYG 115
              ML  +Y+ELG  E      EV+PGCR+  ++  AAS+P  C V IPN  G   GVCY 
Sbjct  95   DHMLSGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPG---GVCY- 150
Query  116  DWAAYP 121
             W  YP
Sbjct  151  -WLGYP 155

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 57.3 bits 378,  Expect = 2e-10
 Identities = 56/110 50%, Positives = 78/110 70%, Gaps = 13/110 11%
Query  7    CNPATGYKVSALTGCRAMVKLQCVGSQVPEAV----LRDCCQQLADINNEWCRCGDLSSM 62
            C P  GY + +L  CRA+VK QCVG++ P AV     +DCC++LA +++ WCRC  L+ M
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHM 100
Query  63   LRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWA 118
            +  +Y+ELG  + G    EV+PGCR+  ++  AAS+P  C V IPN +G   GVCY  W 
Sbjct  101  VGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--WL 155
Query  119  AYP 121
             YP
Sbjct  156  GYP 158

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 56.9 bits 375,  Expect = 2e-10
 Identities = 56/110 50%, Positives = 76/110 69%, Gaps = 14/110 12%
Query  7    CNPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSS 61
            C P  GY + +L  CRA+VK QCVG   P     E + +DCC+QLA +++ WCRC  L+ 
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 100
Query  62   MLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDW 117
            M+  +Y+ELG  + G    EV+PGCR+  ++  AAS+P  C V IPN +G   GVCY  W
Sbjct  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--W 155
Query  118  AAYP 121
              YP
Sbjct  156  LGYP 159

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 55.9 bits 367,  Expect = 5e-10
 Identities = 55/110 50%, Positives = 76/110 69%, Gaps = 14/110 12%
Query  7    CNPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSS 61
            C P  GY + +L  CRA+VK QCV +  P     E + +DCC+QLA +++ WCRC  L+ 
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH 100
Query  62   MLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDW 117
            M+  +Y+ELG  + G    EV+PGCR+  ++  AAS+P  C V IPN +G   GVCY  W
Sbjct  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--W 155
Query  118  AAYP 121
              YP
Sbjct  156  LGYP 159

Sequence Alignment: 13. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 55.7 bits 365,  Expect = 6e-10
 Identities = 55/109 50%, Positives = 75/109 68%, Gaps = 14/109 12%
Query  7    CNPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSS 61
            C P  GY + +L  CRA+VK QCVG   P     E + +DCC+QLA +++ WCRC  L+ 
Sbjct  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 93
Query  62   MLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDW 117
            M+  +Y+ELG  + G    EV+PGCR+  ++  AAS+P  C V IPN +G   GVCY  W
Sbjct  94   MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--W 148
Query  118  AAY 120
              Y
Sbjct  149  LGY 151

Sequence Alignment: 14. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 54.7 bits 357,  Expect = 1e-09
 Identities = 57/112 50%, Positives = 73/112 65%, Gaps = 12/112 10%
Query  3    PWSWCNPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADINNEWCRCGDL 59
            P   C P  GY +  L  CRA+VK QCVG   +   E V RDCC+QLA +++ WCRC  +
Sbjct  38   PAPLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAI 97
Query  60   SSMLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYG 115
            S ML  +Y+ELG  + G    EV+ GCR+  ++  AAS+P  C V IPN  G   GVCY 
Sbjct  98   SHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG---GVCY- 153
Query  116  DWAA 119
             W A
Sbjct  154  -WLA 156

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 54.4 bits 355,  Expect = 1e-09
 Identities = 56/108 51%, Positives = 72/108 66%, Gaps = 10/108 9%
Query  7    CNPATGYKVSALTGCRAMVKLQCVGSQVP-EAVLRDCCQQLADINNEWCRCGDLSSMLRS 65
            C P  GY + +L  CRA+VK QC GS    E V RDCC+QLA +++ WCRC  +S ML  
Sbjct  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
Query  66   VYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAA 119
            +Y+ELG  + G    EV+ GCR+  ++  AAS+P  C V IPN  G   GVCY  W A
Sbjct  101  IYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG---GVCY--WLA 153

Sequence Alignment: 16. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 51.0 bits 327,  Expect = 1e-08
 Identities = 53/110 48%, Positives = 66/110 60%, Gaps = 10/110 9%
Query  3    PWSWCNPATGYKVSALTGCRAMVKLQCVG-SQVPEAVLRDCCQQLADINNEWCRCGDLSS 61
            P   C P  GY    L  CRA VK QCV    + E V R CC+QLA I++ WCRC  L+ 
Sbjct  37   PGQLCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNH 96
Query  62   MLRSVYQELGVREG----KEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDW 117
            MLR +Y+E    +      EV+ GCR+  ++  AAS+P  C V IPN  G   GVCY  W
Sbjct  97   MLRIIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVG---GVCY--W 151

Sequence Alignment: 17. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 46.4 bits 291,  Expect = 2e-07
 Identities = 44/93 47%, Positives = 65/93 69%, Gaps = 13/93 13%
Query  24   MVKLQCVGSQ----VPEAVLRDCCQQLADINNEWCRCGDLSSMLRSVYQELGVRE-GK-- 76
            +VK QCV ++      E + +DCC+QLA +++ WCRC  L+ M+  +Y+ELG  + G   
Sbjct  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
Query  77   -EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAYP 121
             EV+PGCR+  ++   A++P  C V IPN +G   GVCY  W  YP
Sbjct  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTG---GVCY--WLGYP 102

Sequence Alignment: 18. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 46.4 bits 291,  Expect = 2e-07
 Identities = 46/95 48%, Positives = 64/95 67%, Gaps = 14/95 14%
Query  22   RAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSSMLRSVYQELGVRE-G 75
            R  VK QCV +  P     E + +DCC+QLA +++ WCRC  L+ M+  +Y+ELG  + G
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  76   K---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAYP 121
                EV+PGCR+  ++    S+P  C V IPN +G   GVCY  W  YP
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTG---GVCY--WLGYP 104

Sequence Alignment: 19. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 46.0 bits 288,  Expect = 3e-07
 Identities = 44/89 49%, Positives = 63/89 70%, Gaps = 14/89 15%
Query  28   QCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSSMLRSVYQELGVRE-GK---EV 78
            QCVG +       + + +DCC+QLA +++ WCRC  L+ M+  +Y+ELG  + G    EV
Sbjct  9    QCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV 68
Query  79   LPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAYP 121
            +PGCR+  ++  AAS+P  C V IPN +G   GVCY  W  YP
Sbjct  69   FPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--WLGYP 106

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P10846

 Score = 37.9 bits 226,  Expect = 4e-05
 Identities = 31/44 70%, Positives = 34/44 77%, Gaps = 1/44 2%
Query  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQ 45
            SGPW  C P   +KV AL GCR ++ LQC GSQVPEAVLRDCCQQ
Sbjct  1    SGPW-MCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44

Sequence Alignment: 21. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 38.2 bits 222,  Expect = 0.0001
 Identities = 44/110 40%, Positives = 59/110 53%, Gaps = 13/110 11%
Query  3    PWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPE--AVLRDCCQQLADINNEWCRCGDLS 60
            P   C P  GY +  L     + +   +G   P   AV  DCC+Q+  ++  WCRC  +S
Sbjct  38   PGPLCQPGMGYPMYPLR-VAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAIS 96
Query  61   SMLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGD 116
             ML  +Y+ELG  + G    EV+ GCR+          P V +V IPN  G   GVCY  
Sbjct  97   HMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG---GVCY-- 150
Query  117  WAA 119
            W A
Sbjct  151  WLA 153

Sequence Alignment: 22. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 35.8 bits 205,  Expect = 0.0003
 Identities = 27/57 47%, Positives = 35/57 61%, Gaps = 3/57 5%
Query  3    PWSWCNPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADINNEWCRCGDL 59
            P   C P   Y   +L  CR +V+ QCVG   S   E V +DCC+QLA +++ WCRCG L
Sbjct  35   PGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.