The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE
GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV
IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE
KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA33947 Gly m conglycinin 218 1395 258.7 1e-70
O22120 Gly m 5.0101 543 1366 253.3 1.1e-68
CAA35691 Gly m conglycinin 605 1366 253.2 1.3e-68
Q9FZP9 Gly m 5.0201 559 1280 237.9 4.8e-64
AAB01374 Gly m conglycinin 639 1247 232.0 3.3e-62
AAB23463 Gly m conglycinin 439 1184 220.9 5.1e-59
Q198W3 Vig r 2.0101 453 982 184.8 3.7e-48
B1NPN8 Vig r 2.0201 454 982 184.8 3.7e-48
ACB05815 Lup an 1.0101 611 836 158.7 3.7e-40
CAD87731 Len c 1.0102 415 829 157.5 5.5e-40
CAF25233 Pis s 1.0102 415 829 157.5 5.5e-40
CAF25232 Pis s 1.0101 415 829 157.5 5.5e-40
CAD87730 Len c 1.0101 418 451 90.1 1.1e-19
P43237 Ara h 1 614 413 83.2 2e-17
P43238 Ara h 1 626 410 82.7 2.9e-17
AAM54366 Jug n 2 481 355 72.9 1.9e-14
AAL86739 Cor a 11 448 353 72.6 2.2e-14
AAF18269 Jug r 2 593 355 72.9 2.4e-14
AAK15089 Ses i 3 585 341 70.4 1.4e-13
EF116865 Pis v 3.0101 519 334 69.2 2.8e-13
V9VGU0 Pin k 2.0101 463 325 67.6 7.4e-13
AAM73729 Ana o 1.0102 536 318 66.3 2.1e-12
AAM73730 Ana o 1.0101 538 318 66.3 2.1e-12
Q9SPL4 Mac i 1.0201 666 281 59.6 2.7e-10
Q9SPL3 Mac i 1.0101 625 274 58.4 5.8e-10
P09801 Gos h 1 588 260 55.9 3.1e-09
P09799 Gos h 2 605 234 51.3 7.9e-08
B3STU4 Car i 2.0101 792 212 47.3 1.7e-06
A0A2I4E5L6 Jug r 6.0101 502 199 45.1 4.8e-06
A0A0S3B0K0 Coc n 1.0101 490 152 36.7 0.0015
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 258.7 bits 1395,  Expect = 1e-70
 Identities = 218/218 100%, Positives = 218/218 100%, Gaps = 0/218 0%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
            GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
Query  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
            IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE
Sbjct  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
Query  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218
            KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY
Sbjct  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218

Sequence Alignment: 2. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 253.3 bits 1366,  Expect = 1e-68
 Identities = 214/218 98%, Positives = 215/218 98%, Gaps = 0/218 0%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SKRAKSSSRKTISSEDKPFNL SRDPIYS KLGKFFEITPEKNPQLRDLDIFLSIVDMNE
Sbjct  326  SKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 385
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
            GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV
Sbjct  386  GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 445
Query  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
            IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE
Sbjct  446  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 505
Query  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218
            KLLKNQRESYFVDAQP +KEEGNKGRKGPLSSILRAFY
Sbjct  506  KLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 543

Sequence Alignment: 3. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 253.2 bits 1366,  Expect = 1e-68
 Identities = 214/218 98%, Positives = 215/218 98%, Gaps = 0/218 0%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SKRAKSSSRKTISSEDKPFNL SRDPIYS KLGKFFEITPEKNPQLRDLDIFLSIVDMNE
Sbjct  388  SKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 447
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
            GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV
Sbjct  448  GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 507
Query  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
            IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE
Sbjct  508  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 567
Query  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218
            KLLKNQRESYFVDAQP +KEEGNKGRKGPLSSILRAFY
Sbjct  568  KLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 605

Sequence Alignment: 4. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 237.9 bits 1280,  Expect = 5e-64
 Identities = 195/218 89%, Positives = 209/218 95%, Gaps = 0/218 0%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SK AKSSSRKTISSEDKPFNL SRDPIYS KLGK+FEITPEKNPQLRDLD+FLS+VDMNE
Sbjct  342  SKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNE 401
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
            GAL+LPHFNSKAIV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKYRAELSEQDIFV
Sbjct  402  GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV 461
Query  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
            IPAGYPVVVNATS+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQELAFPGSA+ +E
Sbjct  462  IPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIE 521
Query  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218
             L+K+Q ESYFVDAQP +KEEGNKGRKGPLSSILRAFY
Sbjct  522  NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 559

Sequence Alignment: 5. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 232.0 bits 1247,  Expect = 3e-62
 Identities = 191/217 88%, Positives = 208/217 95%, Gaps = 1/217 0%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SK AKSSSRKTISSEDKPFNLGSRDPIYS KLGK+FEIT ++NPQLRDLD+FLS+VDMNE
Sbjct  423  SKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNE 481
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
            GAL+LPHFNSKAIV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKYRAELSEQDIFV
Sbjct  482  GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV 541
Query  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
            IPAGYPV+VNATS+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQELAFP SA+ +E
Sbjct  542  IPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIE 601
Query  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218
             L+K+Q ESYFVDAQP +KEEGNKGRKGPLSSILRAFY
Sbjct  602  NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639

Sequence Alignment: 6. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 220.9 bits 1184,  Expect = 5e-59
 Identities = 181/218 83%, Positives = 201/218 92%, Gaps = 0/218 0%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            S+RAKSSSRKTISSED+PFNL SR+PIYS  +GKFFEITPEKNPQLRDLDIFLS VD+NE
Sbjct  222  SRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINE 281
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
            GALLLPHFNSKAIVILVINEGDANIELVG+KEQQQ+Q+QEE+PLEV++YRAELSE D+FV
Sbjct  282  GALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFV 341
Query  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
            IPA YP VVNATSNLNF+A GINAENNQRNFLAG +DNV+ QI  QVQELAFPGSAQ VE
Sbjct  342  IPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVE 401
Query  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218
            +LLK QRESYFVDAQP +KEEG+KGRKGP+ SIL A+Y
Sbjct  402  RLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY 439

Sequence Alignment: 7. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 184.8 bits 982,  Expect = 4e-48
 Identities = 149/213 69%, Positives = 186/213 87%, Gaps = 6/213 2%
Query  2    KRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG 61
            K AKSSSRK +SS+D+PFNL + +PIYS K+G+++EITPEKNPQL+DLD+F+S VDM EG
Sbjct  239  KHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEG 298
Query  62   ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVI 121
             LLLPH+NSKAIVILVINEG+A IELVG      +QQQ+++ LEV++YRAELSE D+FVI
Sbjct  299  GLLLPHYNSKAIVILVINEGEAKIELVG----PSDQQQQDESLEVQRYRAELSEDDVFVI 354
Query  122  PAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEK 181
            PA YPV +NATSNLNFFA GINAENNQRNFLAG +DNV+S+IP++V +++FP S   VEK
Sbjct  355  PAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEK 414
Query  182  LLKNQRESYFVDAQPNE--KEEGNKGRKGPLSSILRAFY 218
            L+K Q ES+FVDAQP +  +EEG+KGRKG LSSIL ++Y
Sbjct  415  LIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY 453

Sequence Alignment: 8. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 184.8 bits 982,  Expect = 4e-48
 Identities = 146/210 69%, Positives = 182/210 86%, Gaps = 2/210 0%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            +K AKSSS+K++SSED+PFNL ++ PIYS KLG++FEITPEKNPQLRDLD+F+  VDM E
Sbjct  241  TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE 300
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
            G+LLLPH+NSKAIVILVINEG ANIELVG +EQQ++Q+++E+  EV++YRAELSE D+F+
Sbjct  301  GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI 360
Query  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
            IPA YPV +NATSNLNFFA GINAENNQRNFLAG +DNVIS+IP++V ++ FP S + V+
Sbjct  361  IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK 420
Query  181  KLLKNQRESYFVDAQPN--EKEEGNKGRKGPL 210
            KL+K Q ES FVDAQP   E+EE  KG KGP+
Sbjct  421  KLIKKQSESQFVDAQPEQQEREEARKGGKGPF 452

Sequence Alignment: 9. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 158.7 bits 836,  Expect = 4e-40
 Identities = 124/217 57%, Positives = 176/217 81%, Gaps = 9/217 4%
Query  2    KRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG 61
            K A+SSS +   SE  PFNL S  PIYS K+G F+EITP+ NPQ++DL+I L+  ++NEG
Sbjct  386  KHAQSSSGEGKPSESGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEG 445
Query  62   ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLE-----VRKYRAELSEQ 116
            ALLLPH+NSKAI I+V++EG+ N ELVG+++QQ++Q ++E+  E     VR+Y  +LS+ 
Sbjct  446  ALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQRQQDEQEEEYEQGEEEVRRYSDKLSKG 505
Query  117  DIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSA 176
            D+F+IPAG+P+ +NA+SNL ++  GINA  NQRNFLAGS+DNVI Q+  +V+EL FPGS 
Sbjct  506  DVFIIPAGHPLSINASSNLRLLGFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSI 565
Query  177  QAVEKLLKNQRESYFVDAQPNEKE----EGNKGRKGPLSSILRAFY 218
            + VE+L+KNQ++SYF +AQP +++    EG +GR+GP+SSIL A+Y
Sbjct  566  EDVERLIKNQQQSYFANAQPQQQQQREKEGRRGRRGPISSILNALY 611

Sequence Alignment: 10. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 157.5 bits 829,  Expect = 6e-40
 Identities = 124/200 62%, Positives = 168/200 84%, Gaps = 7/200 3%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SK AKSSS+K++SSE +PFNL SR+PIYS K+GKFFEITPEKNPQL+DLDIF++ V++ E
Sbjct  209  SKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKE 268
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ-------EQQQEEQPLEVRKYRAEL 113
            G+LLLP++NS+AIVI+ +NEG    ELVG + + Q       E+Q+EE   +V++YRA+L
Sbjct  269  GSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQEEETSTQVQRYRAKL 328
Query  114  SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFP 173
            S  D+FV+PAG+PV +NA+S+LN+   GINA+NNQRNFLAG +DNVISQI   V+ELAFP
Sbjct  329  SPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFP 388
Query  174  GSAQAVEKLLKNQRESYFVDAQPNEKE 200
            GS++ V++LL NQ++S+F +AQP + E
Sbjct  389  GSSREVDRLLTNQKQSHFANAQPLQIE 415

Sequence Alignment: 11. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 157.5 bits 829,  Expect = 6e-40
 Identities = 125/200 62%, Positives = 167/200 83%, Gaps = 7/200 3%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SK AKSSS+K++SSE  PFNL SR+PIYS K+GKFFEITPEKN QL+DLDIF++ VD+ E
Sbjct  209  SKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKE 268
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ-------EQQQEEQPLEVRKYRAEL 113
            G+LLLP++NS+AIVI+ + EG  + ELVG + + Q       E+Q+EE   +V+ YRA+L
Sbjct  269  GSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKL 328
Query  114  SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFP 173
            S  D+FVIPAG+PV +NA+S+LN+   GINAENN+RNFLAG +DNVISQ+   V+ELAFP
Sbjct  329  SPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFP 388
Query  174  GSAQAVEKLLKNQRESYFVDAQPNEKE 200
            GS++ V++LLKNQ++SYF +AQP ++E
Sbjct  389  GSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 12. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 157.5 bits 829,  Expect = 6e-40
 Identities = 125/200 62%, Positives = 167/200 83%, Gaps = 7/200 3%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SK AKSSS+K++SSE  PFNL SR+PIYS K+GKFFEITPEKN QL+DLDIF++ VD+ E
Sbjct  209  SKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKE 268
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ-------EQQQEEQPLEVRKYRAEL 113
            G+LLLP++NS+AIVI+ + EG  + ELVG + + Q       E+Q+EE   +V+ YRA+L
Sbjct  269  GSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKL 328
Query  114  SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFP 173
            S  D+FVIPAG+PV +NA+S+LN+   GINAENN+RNFLAG +DNVISQ+   V+ELAFP
Sbjct  329  SPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFP 388
Query  174  GSAQAVEKLLKNQRESYFVDAQPNEKE 200
            GS++ V++LLKNQ++SYF +AQP ++E
Sbjct  389  GSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 13. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 90.1 bits 451,  Expect = 1e-19
 Identities = 127/200 63%, Positives = 169/200 84%, Gaps = 10/200 5%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            SK AKSSS+K++SSE +PFNL SR+PIYS K+GKFFEITPEKNPQL+DLDIF++ V++ E
Sbjct  209  SKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKE 268
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLK-EQQQEQ---------QQEEQPLEVRKYR 110
            G+LLLP++NS+AIVI+ +NEG  + ELVG + E QQEQ         Q+EE   +V++YR
Sbjct  269  GSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYR 328
Query  111  AELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQEL 170
            A LS  D++VIPAG+PV +NA+S+LN+   GINA+NNQRNFLAG +DNVISQI   V+EL
Sbjct  329  ARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKEL 388
Query  171  AFPGSAQAVEKLLKNQRESYFVDAQPNEKE 200
            AFPGS++ V++LL NQ++S+F +AQP + E
Sbjct  389  AFPGSSREVDRLLTNQKQSHFANAQPLQIE 418

Sequence Alignment: 14. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 83.2 bits 413,  Expect = 2e-17
 Identities = 126/217 58%, Positives = 170/217 78%, Gaps = 27/217 12%
Query  1    SKRAKSSSRKTISSED--KPFNLGSRDPIYSKKLGKFFEITPEK-NPQLRDLDIFLSIVD 57
            +K AKS S+K    ED   P NL   +P  S  +G++FE+ P+K NPQL+DLD+ L+ V+
Sbjct  370  TKHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVE 429
Query  58   MNEGALLLPHFNSKAIVILVINEGDANIELVGL-KEQQQ----EQQQEEQPL-------- 104
            + EGAL+LPHFNSKA+VI+V+N+G  N+ELV + KEQQQ    EQ+ EE+          
Sbjct  430  IKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSN 489
Query  105  -EVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI 163
             EVR+Y A L E D+F++PA +PV +NA+S L+++  GINAENN+R FLAG +DNVI QI
Sbjct  490  REVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQI 549
Query  164  PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPN----------EKEEGNKGRKGPLSSI 213
              Q ++LAFPGS + VEKL+KNQRES+FV A+P           ++EE N+G KGPL SI
Sbjct  550  EKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQEEENQGGKGPLLSI 609
Query  214  LRAF 217
            L+AF
Sbjct  610  LKAF 613

Sequence Alignment: 15. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 82.7 bits 410,  Expect = 3e-17
 Identities = 123/217 56%, Positives = 168/217 77%, Gaps = 32/217 14%
Query  1    SKRAKSSSRKTISSED---KPFNLGSRDPIYSKKLGKFFEITPEK-NPQLRDLDIFLSIV 56
            +K AKS S+K    E     P NL   +P  S  +GK+FE+ P+K NPQL+DLD+ L+ V
Sbjct  377  TKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCV 436
Query  57   DMNEGALLLPHFNSKAIVILVINEGDANIELVGL-KEQQQEQQQEEQP----------LE 105
            ++ EGAL+LPHFNSKA+VI+V+N+G  N+ELV + KEQQQ  ++EE+            E
Sbjct  437  EIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNRE 496
Query  106  VRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPS 165
            VR+Y A L E D+F++PA +PV +NA+S L+++  GINAENN+R FLAG +DNVI QI  
Sbjct  497  VRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEK 556
Query  166  QVQELAFPGSAQAVEKLLKNQRESYFVDAQPN-----------------EKEEGNKGRKG 208
            Q ++LAFPGS + VEKL+KNQ+ES+FV A+P                  ++EE N+G KG
Sbjct  557  QAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSPEKESPEKEDQEEENQGGKG 616
Query  209  PLSSILRAF 217
            PL SIL+AF
Sbjct  617  PLLSILKAF 625

Sequence Alignment: 16. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 72.9 bits 355,  Expect = 2e-14
 Identities = 88/214 41%, Positives = 150/214 70%, Gaps = 18/214 8%
Query  1    SKRAKSSSRKTIS--SEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDM 58
            S+ A S+ ++     S   P +L S  P YS ++G+FFE  PE++ QL+++D++++  ++
Sbjct  254  SQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEI 313
Query  59   NEGALLLPHFNSKAIVILVINEGDANIELV-------GLKEQ-QQEQQQEEQPLEVRKYR 110
              GA+++PH+NSKA V++ + EG    E+         +++Q ++EQ++EE     +K  
Sbjct  314  KRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQEEEESTGRFQKVT 373
Query  111  AELSEQDIFVIPAGYPVVVNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQ 168
            A L+  DIFVIPAG+P+ + A+ N N+  +  GIN ENNQRNFLAG Q+++I+Q+  + +
Sbjct  374  ARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQRNFLAG-QNSIINQLEREAK 432
Query  169  ELAFPGSAQAVEKLLKNQRESYFVDAQPNEKE-EGNKGRKGPLSSILR-AFY 218
            EL+F    + +E+++++Q ESYFV   P E++    +GR  PL+SIL  AF+
Sbjct  433  ELSFNMPREEIEEIFESQMESYFV---PTERQSRRGQGRDHPLASILGFAFF 481

Sequence Alignment: 17. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 72.6 bits 353,  Expect = 2e-14
 Identities = 60/180 33%, Positives = 106/180 58%, Gaps = 10/180 5%
Query  18   PFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILV 77
            P NL  + P  S ++G+++E  P+ + QL+DLD+ +S  ++ +G++  P++NS+A  I V
Sbjct  262  PINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISV 321
Query  78   INEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT--SNL 135
            + EG+   E+            +       K  A L    +FV PAG+PV V A+  +NL
Sbjct  322  VVEGEGFFEMACPHLSSSSGSYQ-------KISARLRRGVVFVAPAGHPVAVIASQNNNL 374
Query  136  NFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQ 195
              +   +NA  N R  LAG + N++++     +ELAF   ++ VE+++KNQ +++F    
Sbjct  375  QVLCFEVNAHGNSRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGP 433
Query  196  PNEKEEGNKG 205
              ++EEG +G
Sbjct  434  NKQQEEGGRG 443

Sequence Alignment: 18. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 72.9 bits 355,  Expect = 2e-14
 Identities = 88/214 41%, Positives = 145/214 67%, Gaps = 18/214 8%
Query  1    SKRAKSSSRKTIS--SEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDM 58
            S+ A S+ ++     S   P +L S  P YS ++G+FFE  PE++ QL+++D++++  ++
Sbjct  366  SQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEI 425
Query  59   NEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ--------EQQQEEQPLEVRKYR 110
              GA+++PH+NSKA V++ + EG    E+       Q        EQ++EE     +K  
Sbjct  426  KRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVT 485
Query  111  AELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRNFLAGSQDNVISQIPSQVQ 168
            A L+  DIFVIPAG+P+ + A+ N N+  +G  IN ENNQR+FLAG Q+N+I+Q+  + +
Sbjct  486  ARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-QNNIINQLEREAK 544
Query  169  ELAFPGSAQAVEKLLKNQRESYFVDAQPNEKE-EGNKGRKGPLSSILR-AFY 218
            EL+F    + +E+++++Q ESYFV   P E++    +GR  PL+SIL  AF+
Sbjct  545  ELSFNMPREEIEEIFESQMESYFV---PTERQSRRGQGRDHPLASILDFAFF 593

Sequence Alignment: 19. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 70.4 bits 341,  Expect = 1e-13
 Identities = 59/180 32%, Positives = 113/180 62%, Gaps = 9/180 5%
Query  20   NLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVIN 79
            N+  + P +S + G++ E+   +  QLRDLD+ +S+ ++ +GA+  PH+NSKA  I ++ 
Sbjct  396  NIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVV 455
Query  80   EGDANIELV--GLKEQQQEQQQEEQ--PLEVRKYRAELSEQDIFVIPAGYPVVVNATSNL 135
            +G+   E+    +   +   Q E +  P   ++  + L+   + +IPAG+P V  A+SN 
Sbjct  456  DGEGYFEMACPHMSRSRGSYQGETRGRP-SYQRVASRLTRGTVVIIPAGHPFVAVASSNQ 514
Query  136  NF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVD 193
            N+  +   +NA NN++  LAG + NV++Q+  + +ELAF   A+ VE++ ++Q+E +F  
Sbjct  515  NLQVLCFEVNANNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFK 573
Query  194  AQPNEKEEG 202
              P ++++G
Sbjct  574  G-PRQQQQG 581

Sequence Alignment: 20. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 69.2 bits 334,  Expect = 3e-13
 Identities = 63/202 31%, Positives = 111/202 54%, Gaps = 9/202 4%
Query  1    SKRAKSSSRKTISSEDK-PFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMN 59
            S+R +  S    + +    FNL  +DP  S   G++FE   +  P L++LDI +S V++ 
Sbjct  310  SRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDYPPLQELDIMVSYVNIT 369
Query  60   EGALLLPHFNSKAIVILVINEGDANIELV--GLKEQQQEQQQEEQPLEVRKYRAELSEQD 117
            +G +  P +NS+A  I ++  G+  +E+    L   +   Q++  P   +K  + +    
Sbjct  370  KGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKSGP-SYKKLSSSIRTDS 428
Query  118  IFVIPAGYPVVVNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGS 175
            +FV+PAG+P V  A+ N N+  +   +NAE N R  LAG + N+I  +  + +ELAF   
Sbjct  429  VFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKK-NIIEVMEKEAKELAFKTK 487
Query  176  AQAVEKLLKNQRESYFVDAQPNEKEEGNKGR 206
             + V+K++  Q E +F    P  ++   +GR
Sbjct  488  GEEVDKVFGKQDEEFFFQG-PKWRQH-QQGR 516

Sequence Alignment: 21. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 67.6 bits 325,  Expect = 7e-13
 Identities = 59/198 29%, Positives = 110/198 55%, Gaps = 12/198 6%
Query  2    KRAKSSSRKTISSED-KPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            +R   S+  T +SE  KPFNL ++ P +    G+F    P+ NP L  +D+ +    +N 
Sbjct  250  RRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNP 309
Query  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE-----QQQEEQPLEVRKYRAELSE 115
            G +  P  N+KA  I ++ EG+  IE+      Q+      +++  Q +   + RA L  
Sbjct  310  GTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRT 369
Query  116  QDIFVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAF- 172
              ++V+PAG+P+   A++N  L  +   IN   N+R FLAG ++NV+  +  +V+ L+F 
Sbjct  370  GTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFN 428
Query  173  -PGSAQAVEKLLKNQRESYFVDAQPNEKEE 201
             P   + +E++L+ Q++   +     ++ +
Sbjct  429  IP-RGEEIEEVLQAQKDQVILRGPQRQRRD 457

Sequence Alignment: 22. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 66.3 bits 318,  Expect = 2e-12
 Identities = 57/181 31%, Positives = 101/181 55%, Gaps = 9/181 4%
Query  19   FNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVI 78
            F L  +DP  S K G++FE      P L  LD+ +S  ++ +G + +P +NS+A  I ++
Sbjct  351  FKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIV 410
Query  79   NEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFF 138
              G+  +E+      +    +  +P   +K RA + +  +F++PAG+P    A+ N N+ 
Sbjct  411  VSGEGCVEIA---CPHLSSSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLE 466
Query  139  AIG--INAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP 196
             +   +NAE N R  LAG + N+I  +  + +ELAF    + V+K++  Q E +F    P
Sbjct  467  IVCFEVNAEGNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-P 524
Query  197  NEKEEGNKGR 206
              ++E  +GR
Sbjct  525  EWRKE-KEGR 533

Sequence Alignment: 23. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 66.3 bits 318,  Expect = 2e-12
 Identities = 57/181 31%, Positives = 101/181 55%, Gaps = 9/181 4%
Query  19   FNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVI 78
            F L  +DP  S K G++FE      P L  LD+ +S  ++ +G + +P +NS+A  I ++
Sbjct  353  FKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIV 412
Query  79   NEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFF 138
              G+  +E+      +    +  +P   +K RA + +  +F++PAG+P    A+ N N+ 
Sbjct  413  VSGEGCVEIA---CPHLSSSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLE 468
Query  139  AIG--INAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP 196
             +   +NAE N R  LAG + N+I  +  + +ELAF    + V+K++  Q E +F    P
Sbjct  469  IVCFEVNAEGNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-P 526
Query  197  NEKEEGNKGR 206
              ++E  +GR
Sbjct  527  EWRKE-KEGR 535

Sequence Alignment: 24. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 59.6 bits 281,  Expect = 3e-10
 Identities = 75/206 36%, Positives = 134/206 65%, Gaps = 11/206 5%
Query  9    RKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHF 68
            R+   S   P+NL ++ P+YS K G+ +E+ PE   QL+D+D+ + I ++ +G+++ P F
Sbjct  445  RRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFF 504
Query  69   NSKAIVILVINEGDANIELV-----GLKEQQQ--EQQQEEQPLEVRKYRAELSEQDIFVI 121
            N+++  ++V+  G+A++E+      G    ++  ++++EE+ +   + +A LS+++  V+
Sbjct  505  NTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVV 564
Query  122  PAGYPVVVNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAV 179
            P G+PVV  ++ N N+  FA GINA+NN+ NFLAG + NV+ QI  Q  ELAF    + V
Sbjct  565  PVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEV 624
Query  180  EKLLKNQRESYFVDAQPNEKEEGNKGRKG--PLSSIL 214
            E+L+ +Q ES F       +++ ++  K   PL SIL
Sbjct  625  EELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661

Sequence Alignment: 25. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 58.4 bits 274,  Expect = 6e-10
 Identities = 77/206 37%, Positives = 134/206 65%, Gaps = 11/206 5%
Query  9    RKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHF 68
            R+   S   P+NL ++ P+YS K G+ +E+ PE   QL+D+D+ + I ++ +G+++ P F
Sbjct  404  RRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFF 463
Query  69   NSKAIVILVINEGDANIELV--GLKEQQQ-----EQQQEEQPLEVRKYRAELSEQDIFVI 121
            N+++  ++V+  G+A++E+    L  ++      ++++EE+ +   + RA LS+++  V+
Sbjct  464  NTRSTKVVVVASGEADVEMACPHLSGRHGGRGGGKRHEEEEEVHYEQVRARLSKREAIVV 523
Query  122  PAGYPVVVNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAV 179
             AG+PVV  ++ N N+  FA GINA+NN+ NFLAG + NV+ QI  Q  ELAF  S + V
Sbjct  524  LAGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEV 583
Query  180  EKLLKNQRESYFVDAQPNEKEEGNKGRKG--PLSSIL 214
            E+L+ +Q ES F       +++  +  K   PL SIL
Sbjct  584  EELFNSQDESIFFPGPRQHQQQSPRSTKQQQPLVSIL 620

Sequence Alignment: 26. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 55.9 bits 260,  Expect = 3e-09
 Identities = 86/198 43%, Positives = 133/198 67%, Gaps = 24/198 12%
Query  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
            S+ A S   K  S E   FNL  R P YS + G+F+E  P +  QL D+++ +S + +N+
Sbjct  370  SQEATSPREK--SGERFAFNLLYRTPRYSNQNGRFYEACPREFRQLSDINVTVSALQLNQ 427
Query  61   GALLLPHFNSKAIVILVINEGDANIELVG-----------LKEQQQEQQQEEQ--PLEVR 107
            G++++PH+NSKA  ++++NEG+  +E+V             +EQQQEQ+QEE+    + R
Sbjct  428  GSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQQQEQEQEEERRSGQYR 487
Query  108  KYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG-------INAENNQRNFLAGSQDNVI 160
            K R++LS  DIFV+PA +PV   A+ N N+   G       IN ++NQR F+AG + N +
Sbjct  488  KIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDHNQRIFVAG-KINHV 546
Query  161  SQIPSQVQELAFPGSAQAVEKLLKNQ-RESYFVDAQPNEKEE 201
             Q  SQ +ELAF  S++ V++++ N  +ESYFV  Q     E
Sbjct  547  RQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQRQRASE 588

Sequence Alignment: 27. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 51.3 bits 234,  Expect = 8e-08
 Identities = 80/208 38%, Positives = 137/208 65%, Gaps = 19/208 9%
Query  6    SSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEK-NPQLRDLDIFLSIVDMNEGALL 64
            ++S +   SE   FNL S+ P YS + G+F+E  P     QLR++D  +   ++N+G+++
Sbjct  374  ATSPRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIF 433
Query  65   LPHFNSKAIVILVINEGDANIELV--GLKEQ------QQEQQQEEQPLEVR-----KYRA 111
            +PH+NSKA  ++++ EG+ ++E+V   L  Q      ++E++QEEQ +E R     + RA
Sbjct  434  VPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRA 493
Query  112  ELSEQDIFVIPAGYPVVVNATSN--LNFFAIGI-NAENNQRNFLAGSQDNVISQIPSQVQ 168
            +LS  ++FV+PAG+PV   A+ N  L ++  G+ N ++N+R F+AG  +NV  Q   Q +
Sbjct  494  QLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAK 552
Query  169  ELAFPGSAQAVEKLLKNQ-RESYFVDAQPNEKEEGNKGRKGPLSSIL 214
            ELAF   ++ V++++ N  +ESYFV  +     +  +G   PLS  L
Sbjct  553  ELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSPFL 599

Sequence Alignment: 28. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 47.3 bits 212,  Expect = 2e-06
 Identities = 85/210 40%, Positives = 145/210 69%, Gaps = 19/210 9%
Query  1    SKRAKSSSRKTIS--SEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDM 58
            S+ A S+ ++     S   P +L S+   YS ++G+FFE  PE++ QL+++D++++  ++
Sbjct  562  SQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEI 621
Query  59   NEGALLLPHFNSKAIVILVINEGDANIELV---GLKEQ------QQEQQQEEQPL-EVRK 108
              GA+++PH+NSKA V++ + EG    E+     +  Q      ++EQ++EE    + +K
Sbjct  622  KRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQK 681
Query  109  YRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRNFLAGSQDNVISQIPSQ 166
              A L+  DIFVIPAG+P+ + A+ N N+  +G  IN +NNQRNFLAG Q+N+I+Q+  +
Sbjct  682  VTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAG-QNNIINQLERE 740
Query  167  VQELAFPGSAQAVEKLLKNQRESYFVDAQPNEKE-EGNKGRKGPLSSIL 214
             +EL+F    + +E++++ Q ESYFV   P E++    +GR  PL+SIL
Sbjct  741  AKELSFNMPREEIEEIFERQVESYFV---PMERQSRRGQGRDHPLASIL 786

Sequence Alignment: 29. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 45.1 bits 199,  Expect = 5e-06
 Identities = 67/186 36%, Positives = 113/186 60%, Gaps = 14/186 7%
Query  18   PFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILV 77
            PFNL  + P  S ++G++FE  P++  QL+DLD+ +S  ++ +G++  P++NS+A  I V
Sbjct  301  PFNLFHKRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISV 360
Query  78   INEGDANIELV--GLKEQQQEQQQEEQPLEVRKYRAELSEQDI---------FVIPAGYP 126
            + EG+   E+    L       Q+E      R+ R+  S Q I         FV PAG+P
Sbjct  361  VIEGEGYFEMACPHLSSSGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHP 420
Query  127  VVVNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLK 184
            V V A+ N N+  +   +NA+ N R  LAG ++N++++   + +ELAF   A+ VEK+++
Sbjct  421  VAVIASRNKNLQVLCFDVNAQGNIRFPLAG-KNNIVNEFEKEAKELAFNFPAREVEKIFR 479
Query  185  NQRESYFVDAQPNEKEEGNK 204
            NQ + +F      + EEG +
Sbjct  480  NQDQEFFFPGPSRQPEEGGR 499

Sequence Alignment: 30. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 36.7 bits 152,  Expect = 0.002
 Identities = 49/175 28%, Positives = 84/175 48%, Gaps = 16/175 9%
Query  19   FNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVI 78
            +NL   +P Y    G    I       L+  ++ + +V++  GA+L PH N  A    +I
Sbjct  299  YNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGII 358
Query  79   NEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN--LN 136
              G   I++V              P       A++SE D+F IP  +P    A+    L 
Sbjct  359  LRGSGTIQVVF-------------PNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLE 405
Query  137  FFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP 196
            FF    +A  N+  FL G + +++  +       AF  S + +E+++K QRE+  +   P
Sbjct  406  FFGFTTSARKNRPQFLVG-KSSLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSP 464
Query  197  NEKEEGNKGRK 207
            + + E   G+K
Sbjct  465  HREMEEINGKK 475

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.