The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK
IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV
GDNGVLACAIATHAKIRD
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA01241 Der f 2 138 924 217.8 8.6e-59
Q00855 Der f 2 146 912 215.0 6.1e-58
BAA01239 Der f 2 138 906 213.7 1.5e-57
CAK22338 Der p 2.0114 146 843 199.3 3.4e-53
P49278 Der p 2 146 838 198.1 7.5e-53
ABA39438 Der f 2.0109 129 835 197.4 1.1e-52
CAQ68249 Der p 2.0115 129 807 191.0 9e-51
ABA39437 Der p 2.0109 129 807 191.0 9e-51
AAK30133 Der f 2 170 807 191.1 1.2e-50
Q9TZZ2 Eur m 2 145 804 190.4 1.6e-50
AAC82350 Eur m 2.0102 135 790 187.2 1.4e-49
O02380 Tyr p 2 141 404 99.0 5e-23
CAB76459 Gly d 2.0201 125 395 96.9 1.9e-22
A6XEN8 Blo t 2.0104 142 395 96.9 2.1e-22
A6XEN9 Blo t 2.0104 142 395 96.9 2.1e-22
P80384 Lep d 2 141 394 96.7 2.5e-22
CAD32314 Lep d 2.0202 141 391 96.0 3.9e-22
CAD32313 Lep d 2.0102 141 389 95.6 5.4e-22
A6XEP1 Blo t 2.0104 142 388 95.3 6.4e-22
A6XEP2 Blo t 2.0104 142 388 95.3 6.4e-22
A6XEP6 Blo t 2.0104 142 388 95.3 6.4e-22
A6XEP3 Blo t 2.0104 142 387 95.1 7.5e-22
CAA58755 Lep d 2.0201 141 386 94.9 8.7e-22
A6XEP5 Blo t 2.0104 142 384 94.4 1.2e-21
BAX34757 Der f 35.0101 143 382 94.0 1.7e-21
A6XEP4 Blo t 2.0104 142 381 93.7 1.9e-21
A6XEP0 Blo t 2.0104 142 378 93.1 3.1e-21
AAQ73482 Blo t 2.0102 142 374 92.1 5.9e-21
AAQ73483 Blo t 2.0101 144 373 91.9 7e-21
CAB59976 Gly d 2.0101 128 367 90.5 1.6e-20
AAQ73481 Blo t 2.0103 141 340 84.4 1.3e-18
CAA57160 Lep d 2.0101 98 298 74.8 6.9e-16
ABG76195 Der f 22.0101 155 269 68.2 1.1e-13
Q28895 Can f 7.0101 149 172 46.0 4.8e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 217.8 bits 924,  Expect = 9e-59
 Identities = 138/138 100%, Positives = 138/138 100%, Gaps = 0/138 0%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
Query  121  GDNGVLACAIATHAKIRD 138
            GDNGVLACAIATHAKIRD
Sbjct  121  GDNGVLACAIATHAKIRD 138

Sequence Alignment: 2. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 215.0 bits 912,  Expect = 6e-58
 Identities = 135/138 97%, Positives = 136/138 98%, Gaps = 0/138 0%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK
Sbjct  9    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 68
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYD KYTWNVPKIAPKSENVVVTVKL+
Sbjct  69   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 128
Query  121  GDNGVLACAIATHAKIRD 138
            GDNGVLACAIATH KIRD
Sbjct  129  GDNGVLACAIATHGKIRD 146

Sequence Alignment: 3. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 213.7 bits 906,  Expect = 1e-57
 Identities = 134/138 97%, Positives = 136/138 98%, Gaps = 0/138 0%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            IEIKASLDGLEIDVPGIDTNACHF+KCPLVKGQQYD KYTWNVPKIAPKSENVVVTVKL+
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 120
Query  121  GDNGVLACAIATHAKIRD 138
            GDNGVLACAIATH KIRD
Sbjct  121  GDNGVLACAIATHGKIRD 138

Sequence Alignment: 4. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 199.3 bits 843,  Expect = 3e-53
 Identities = 122/138 88%, Positives = 132/138 95%, Gaps = 0/138 0%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            SLLVAAV ADQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEALF+ANQNTK AK
Sbjct  9    SLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAK 68
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            IEIKAS+DGLE+DVPGID NACH++KCPLVKGQQYD KYTWNVPKIAPKSENVVVTVK++
Sbjct  69   IEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVL 128
Query  121  GDNGVLACAIATHAKIRD 138
            GDNGVLACAIATHAKIRD
Sbjct  129  GDNGVLACAIATHAKIRD 146

Sequence Alignment: 5. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 198.1 bits 838,  Expect = 7e-53
 Identities = 121/138 87%, Positives = 132/138 95%, Gaps = 0/138 0%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            SLLVAAV  DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQNTKTAK
Sbjct  9    SLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAK 68
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            IEIKAS+DGLE+DVPGID NACH+MKCPLVKGQQYD KYTWNVPKIAPKSENVVVTVK++
Sbjct  69   IEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVM 128
Query  121  GDNGVLACAIATHAKIRD 138
            GD+GVLACAIATHAKIRD
Sbjct  129  GDDGVLACAIATHAKIRD 146

Sequence Alignment: 6. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 197.4 bits 835,  Expect = 1e-52
 Identities = 121/129 93%, Positives = 127/129 98%, Gaps = 0/129 0%
Query  10   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 69
            DQVDVKDCANNEIKKVMVDG HGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKA+++G
Sbjct  1    DQVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANING 60
Query  70   LEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLACA 129
            LE+DVPGIDTNACHF+KCPLVKGQQYD KYTWNVPKIAPKSENVVVTVKL+GDNGVLACA
Sbjct  61   LEVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 120
Query  130  IATHAKIRD 138
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 7. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 191.0 bits 807,  Expect = 9e-51
 Identities = 114/129 88%, Positives = 125/129 96%, Gaps = 0/129 0%
Query  10   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 69
            DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  70   LEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLACA 129
            LE+DVPGID NACH+MKCPLVKGQQYD KYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACA 120
Query  130  IATHAKIRD 138
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 8. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 191.0 bits 807,  Expect = 9e-51
 Identities = 114/129 88%, Positives = 125/129 96%, Gaps = 0/129 0%
Query  10   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 69
            DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  70   LEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLACA 129
            LE+DVPGID NACH+MKCPLVKGQQYD KYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
Query  130  IATHAKIRD 138
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 9. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 191.1 bits 807,  Expect = 1e-50
 Identities = 135/138 97%, Positives = 136/138 98%, Gaps = 29/138 21%
Query  1    SLLVAAVVADQVDVKDC-----------------------------ANNEIKKVMVDGCH 31
            SLLVAAVVADQVDVKDC                             ANNEIKKVMVDGCH
Sbjct  4    SLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCH 63
Query  32   GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVK 91
            GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVK
Sbjct  64   GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVK 123
Query  92   GQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLACAIATHAKIRD 138
            GQQYD KYTWNVPKIAPKSENVVVTVKL+GDNGVLACAIATH KIRD
Sbjct  124  GQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170

Sequence Alignment: 10. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 190.4 bits 804,  Expect = 2e-50
 Identities = 115/138 83%, Positives = 127/138 92%, Gaps = 0/138 0%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            SLLVAAV ADQVD+KDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN+  AK
Sbjct  8    SLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAK 67
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            IEIKA++DG+EIDVPGID N CHFMKCPLVKGQ+YD KYTWNVP+IAPKSENVVVTVKL+
Sbjct  68   IEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLL 127
Query  121  GDNGVLACAIATHAKIRD 138
            GDNGVLACAIATHAKIRD
Sbjct  128  GDNGVLACAIATHAKIRD 145

Sequence Alignment: 11. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 187.2 bits 790,  Expect = 1e-49
 Identities = 113/135 83%, Positives = 124/135 91%, Gaps = 0/135 0%
Query  4    VAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEI 63
            VAAV ADQVDVKDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN+  AKIEI
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  64   KASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDN 123
            KA++DG+EIDVPGID N CHFMKCPLVKGQ+YD KYTWNVP+IAPKSENVVVTVKL+GDN
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  124  GVLACAIATHAKIRD 138
            GVLACAIATHAKIRD
Sbjct  121  GVLACAIATHAKIRD 135

Sequence Alignment: 12. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 99.0 bits 404,  Expect = 5e-23
 Identities = 62/129 48%, Positives = 84/129 65%, Gaps = 7/129 5%
Query  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
            LVA   A QV   DC   EI  V VDGC G D C+IH+ KP  + A F ANQ+T   +++
Sbjct  9    LVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVK 67
Query  63   IKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV-- 120
            +   L+GLE+ +PGI+T+ C  +KCPL KG +Y   Y+ NVP + P   N+   VKL+  
Sbjct  68   VTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLAT 124
Query  121  GDNGVLAC-AIATHAK 135
            G++GVLAC A+ T  K
Sbjct  125  GEHGVLACGAVNTDVK 140

Sequence Alignment: 13. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 96.9 bits 395,  Expect = 2e-22
 Identities = 59/116 50%, Positives = 79/116 68%, Gaps = 2/116 1%
Query  11   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGL 70
            ++  KDC   E+ ++ +  C G D C+IHRGKP+TLEA F ANQ+T  A I++ A + G 
Sbjct  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  71   EIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLAC 128
             I VPG++T+ C F+KCP+ KG   D KYT  VP I PK +   VT +LVGD+GVLAC
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117

Sequence Alignment: 14. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 96.9 bits 395,  Expect = 2e-22
 Identities = 56/126 44%, Positives = 84/126 66%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + + GC G D C IH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A+++G+E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  67   IKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 96.9 bits 395,  Expect = 2e-22
 Identities = 55/126 43%, Positives = 84/126 66%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + + GC G D C IH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A+++G+E+ VPG+D + C    CPL KGQ+Y+  Y+  +P + P  + V  T  LV
Sbjct  67   IKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 16. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 96.7 bits 394,  Expect = 2e-22
 Identities = 57/131 43%, Positives = 85/131 64%, Gaps = 3/131 2%
Query  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
            LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+T    I+
Sbjct  10   LVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIK 68
Query  63   IKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGD 122
            + A + G  I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   VT +L+GD
Sbjct  69   VLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGD 127
Query  123  NGVLACAIATHAKI 136
            +GV+AC    H ++
Sbjct  128  HGVMACG-TVHGQV 140

Sequence Alignment: 17. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 96.0 bits 391,  Expect = 4e-22
 Identities = 57/131 43%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
            LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+T    I+
Sbjct  10   LVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIK 68
Query  63   IKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGD 122
            + A + G  I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK + V VT +LVGD
Sbjct  69   VLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGD 127
Query  123  NGVLACAIATHAKI 136
            +GV+AC    H ++
Sbjct  128  HGVMACG-TIHGQV 140

Sequence Alignment: 18. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 95.6 bits 389,  Expect = 5e-22
 Identities = 56/131 42%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
            LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+T    I+
Sbjct  10   LVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIK 68
Query  63   IKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGD 122
            +   + G  I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   VT +L+GD
Sbjct  69   VLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGD 127
Query  123  NGVLACAIATHAKI 136
            +GV+AC    H ++
Sbjct  128  HGVMACG-TVHGQV 140

Sequence Alignment: 19. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 95.3 bits 388,  Expect = 6e-22
 Identities = 56/126 44%, Positives = 83/126 65%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 20. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 95.3 bits 388,  Expect = 6e-22
 Identities = 56/126 44%, Positives = 83/126 65%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 21. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 95.3 bits 388,  Expect = 6e-22
 Identities = 56/126 44%, Positives = 83/126 65%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 22. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 95.1 bits 387,  Expect = 7e-22
 Identities = 55/126 43%, Positives = 83/126 65%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + +  T  LV
Sbjct  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTIT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 23. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 94.9 bits 386,  Expect = 9e-22
 Identities = 56/131 42%, Positives = 83/131 63%, Gaps = 3/131 2%
Query  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
            LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+T    I+
Sbjct  10   LVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIK 68
Query  63   IKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGD 122
            + A + G  I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK +   VT +LVGD
Sbjct  69   VLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-ADVTAELVGD 127
Query  123  NGVLACAIATHAKI 136
            +GV+AC    H ++
Sbjct  128  HGVMACG-TIHGQV 140

Sequence Alignment: 24. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 94.4 bits 384,  Expect = 1e-21
 Identities = 54/126 42%, Positives = 83/126 65%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + +  C G D C IH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYATAGDVKFTDCAHGEVTSLDLSRCSG-DHCTIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A+++G+E+ VPG+D + C    CPL KGQ+Y+  Y+  +P + P  + V  T  LV
Sbjct  67   IKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 25. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 94.0 bits 382,  Expect = 2e-21
 Identities = 52/135 38%, Positives = 88/135 65%, Gaps = 3/135 2%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +L  A   A ++   DC + E+  + V GC G D C++H+GK   L+    +NQ+++  K
Sbjct  9    ALTFAVASAGKMKFVDCGHKEVISLDVSGCEG-DYCVLHKGKTIDLDMKCKSNQDSEHLK 67
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            + I A ++G+EI+VPG D + CH+++CP+ KGQ YD KY++NVP + P  +  + T K++
Sbjct  68   LIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGTL-TAKVI 126
Query  121  GDNGVLACAIATHAKIRD 138
            GDNG++ C +  + +I D
Sbjct  127  GDNGLVGC-LKLNGEIAD 143

Sequence Alignment: 26. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 93.7 bits 381,  Expect = 2e-21
 Identities = 55/126 43%, Positives = 82/126 65%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + + GC   D CIIH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGC-SDDHCIIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 27. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 93.1 bits 378,  Expect = 3e-21
 Identities = 55/126 43%, Positives = 82/126 65%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+   A  V   DCA+ E+  + + GC G D CII +GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 28. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 92.1 bits 374,  Expect = 6e-21
 Identities = 54/126 42%, Positives = 81/126 64%, Gaps = 2/126 1%
Query  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
            +LLV+      V    CA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +
Sbjct  8    ALLVSPAAGGDVKFTACAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLE 66
Query  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
Query  121  GDNGVLAC 128
            GD+GV+AC
Sbjct  126  GDHGVVAC 133

Sequence Alignment: 29. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 91.9 bits 373,  Expect = 7e-21
 Identities = 53/118 44%, Positives = 78/118 66%, Gaps = 2/118 1%
Query  9    ADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLD 68
            A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +I+I A ++
Sbjct  18   AGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN 76
Query  69   GLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLAC 128
             +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LVGD+GV+AC
Sbjct  77   NIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 135

Sequence Alignment: 30. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 90.5 bits 367,  Expect = 2e-20
 Identities = 53/116 45%, Positives = 84/116 72%, Gaps = 4/116 3%
Query  11   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG- 69
            +++  DC +NEIK++ V  C G + C+IHRGKP+TL+A FDANQ+T +  + + A +DG 
Sbjct  2    KMNFTDCGHNEIKELSVSNCTG-NYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  70   LEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWN-VPKIAPKSENVVVTVKLVGDNGVLAC 128
            + ID+PG++TNAC +MKCP+ KG++ +  Y    +P   P+ +   V  +L+G++GVLAC
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119

Sequence Alignment: 31. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 84.4 bits 340,  Expect = 1e-18
 Identities = 48/106 45%, Positives = 72/106 67%, Gaps = 2/106 1%
Query  21   EIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTN 80
            E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +I+I A ++ +E+ VPG+D +
Sbjct  27   EVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKD 85
Query  81   ACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLAC 128
             C    CPL KGQ+Y+  Y+  +P I P  + V  T  LVGD+GV+AC
Sbjct  86   GCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 132

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 74.8 bits 298,  Expect = 7e-16
 Identities = 44/97 45%, Positives = 64/97 65%, Gaps = 2/97 2%
Query  38   IHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDA 97
            IHRG+  TLEA F ANQ+T    I++ A + G  I VPG++T+ C F+KCP+ KG+  D 
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  98   KYTWNVPKIAPKSENVVVTVKLVGDNGVLACAIATHAKI 136
             Y+  +P I PK +   VT +L+GD+GV+AC    H ++
Sbjct  61   IYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQV 97

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 68.2 bits 269,  Expect = 1e-13
 Identities = 56/124 45%, Positives = 75/124 60%, Gaps = 11/124 8%
Query  3    LVAAVVADQVDV--KDCANNEIKKVMVDGCHGSDP-CIIHRGKPFTLEALFDANQNTKTA 59
            L AAV AD+ +V  KDC +NEIK   V G + +   C+IH+     L   F AN+NT   
Sbjct  14   LAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFVANENTGN- 72
Query  60   KIEIK--ASLDGLEIDVPGID-TNAC--HFMKCPLVKGQQYDAKYTWNVPKIAPKSENVV 114
            KI  +   +L G+E+  PGID T+AC  H + CPL KGQ Y+    +N+    P + NV 
Sbjct  73   KINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDDVP-TANVT 131
Query  115  VTVKLV-GDNGVLAC 128
             TV+L  G  G L C
Sbjct  132  ATVRLENGHGGDLLC 146

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 46.0 bits 172,  Expect = 5e-07
 Identities = 33/109 30%, Positives = 60/109 55%, Gaps = 7/109 6%
Query  12   VDVKDC--ANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 69
            V  KDC  A   IK++ V+ C  + PC +H+G+ +++   F +N  ++++K  +   + G
Sbjct  22   VHFKDCGSAVGVIKELNVNPCP-AQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLG 80
Query  70   LEIDVPGIDTNACHF-MKCPLVKGQQYDAKYTWNVP-KIAPKSENVVVTVKLVGDN 123
            + +  P  + + C   + CP+ K + Y   Y   +P K    S  +VV   L+GDN
Sbjct  81   VAVPFPIPEADGCKSGINCPIQKDKTYS--YLNKLPVKNEYPSIKLVVQWMLLGDN 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.