The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL
PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH
RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF
GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN
ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK
NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD87731 Len c 1.0102 415 2664 613.6 5.5e-177
CAD87730 Len c 1.0101 418 2514 579.4 1.1e-166
CAF25232 Pis s 1.0101 415 2459 566.9 6.4e-163
CAF25233 Pis s 1.0102 415 2438 562.1 1.8e-161
ACB05815 Lup an 1.0101 611 1621 375.8 3.2e-105
Q9FZP9 Gly m 5.0201 559 1179 275.0 6.1e-75
B1NPN8 Vig r 2.0201 454 1166 272.1 3.8e-74
Q198W3 Vig r 2.0101 453 1152 268.9 3.4e-73
O22120 Gly m 5.0101 543 1153 269.1 3.6e-73
CAA35691 Gly m conglycinin 605 1153 269.1 4.1e-73
P43238 Ara h 1 626 1065 249.0 4.6e-67
P43237 Ara h 1 614 1062 248.3 7.2e-67
AAB01374 Gly m conglycinin 639 880 206.8 2.3e-54
AAA33947 Gly m conglycinin 218 829 195.6 2e-51
AAB23463 Gly m conglycinin 439 671 159.3 3.3e-40
P09799 Gos h 2 605 673 159.7 3.5e-40
P09801 Gos h 1 588 659 156.5 3.1e-39
Q9SPL3 Mac i 1.0101 625 476 114.8 1.2e-26
AAL86739 Cor a 11 448 470 113.5 2.1e-26
Q9SPL4 Mac i 1.0201 666 471 113.6 2.8e-26
B3STU4 Car i 2.0101 792 455 109.9 4.3e-25
A0A2I4E5L6 Jug r 6.0101 502 450 108.9 5.7e-25
AAM54366 Jug n 2 481 448 108.4 7.4e-25
AAF18269 Jug r 2 593 442 107.0 2.4e-24
AAK15089 Ses i 3 585 437 105.9 5.3e-24
EF116865 Pis v 3.0101 519 427 103.6 2.2e-23
AAM73730 Ana o 1.0101 538 417 101.3 1.1e-22
AAM73729 Ana o 1.0102 536 416 101.1 1.3e-22
V9VGU0 Pin k 2.0101 463 386 94.3 1.3e-20
BAB21619 Gly m Bd28K 473 284 71.0 1.3e-13
A0A0S3B0K0 Coc n 1.0101 490 233 59.4 4.3e-10
QYU76044 Zan b 2.02 383 140 38.3 0.00078
QYS16039 Zan b 2.03 389 128 35.5 0.0053
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 613.6 bits 2664,  Expect = 5e-177
 Identities = 415/415 100%, Positives = 415/415 100%, Gaps = 0/415 0%
Query  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL
Sbjct  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
Query  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
            DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH
Sbjct  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
Query  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
            RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF
Sbjct  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
            GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN
Sbjct  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
Query  301  ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK 360
            ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK
Sbjct  301  ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK 360
Query  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE
Sbjct  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415

Sequence Alignment: 2. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 579.4 bits 2514,  Expect = 1e-166
 Identities = 390/415 93%, Positives = 408/415 98%, Gaps = 3/415 0%
Query  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            SRSDQENPFIFKSNRFQTIYENENGHIRLLQ+FDKRSKIFENLQNYRLLEYKSKPHT+FL
Sbjct  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
Query  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            PQ+TDADFILVVLSGKA+LTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
            DLAIPVN PGQL+SFLLSGTQNQPSFLSGF+K+ILEAAFNT+YEEIEKVLLE+QEQ+ QH
Sbjct  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH 180
Query  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
            RRSLRD+RQEI  E+VIVKVSREQI+ELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF
Sbjct  181  RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
            GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKG FELVGQRN
Sbjct  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN 300
Query  301  ENQ---REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGI 357
            ENQ   REEND+EE QEEET+ QVQRYRA+LSPGDV+V+PAGHPVAINASSDLNLIGFGI
Sbjct  301  ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI 360
Query  358  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE
Sbjct  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418

Sequence Alignment: 3. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 566.9 bits 2459,  Expect = 6e-163
 Identities = 382/415 92%, Positives = 399/415 96%, Gaps = 0/415 0%
Query  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            SRSDQENPFIFKSNRFQT+YENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL
Sbjct  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
Query  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            PQYTDADFILVVLSGKA LTVL SNDRNSFNLERGD IKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
            DLAIPVN PGQL+SFLLSGTQNQPS+LSGF+K+ILEAAFNT+YEEIEKVLLE QEQEPQH
Sbjct  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
Query  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
            RRSL+DRRQEIN+ENVIVKVSREQI+ELSKNAKSSSKKSVSSES PFNLRSRNPIYSNKF
Sbjct  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
            GKFFEITPEKN QLQDLDIFVNSV+IKEGSLLLPNYNSRAIVIVTV EGKG FELVGQRN
Sbjct  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
Query  301  ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK 360
            ENQ +END EEEQEEETS QVQ YRAKLSPGDVFV+PAGHPVAINASSDLNLIGFGINA+
Sbjct  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
Query  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            NN+RNFLAGEEDNVISQ++RPVKELAFPGSS EVDRLL NQKQS+FANAQPLQ E
Sbjct  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 4. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 562.1 bits 2438,  Expect = 2e-161
 Identities = 380/415 91%, Positives = 397/415 95%, Gaps = 0/415 0%
Query  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            SRSDQENPFIFKSNRFQT+YENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKP TLFL
Sbjct  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFL 60
Query  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            PQ TDADFILVVLSGKA LTVL SNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
            DL IPVN PGQL+SFLLSGTQNQPS+LSGF+K+ILEAAFNT+YEEIEKVLLE QEQEPQH
Sbjct  121  DLTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
Query  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
            RRSL+DRRQEIN+ENVIVKVSREQI+ELSKNAKSSSKKSVSSES PFNLRSRNPIYSNKF
Sbjct  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
            GKFFEITPEKN QLQDLDIFVNSV+IKEGSLLLPNYNSRAIVIVTV EGKG FELVGQRN
Sbjct  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
Query  301  ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK 360
            ENQ +END EEEQEEETS QVQ YRAKLSPGDVFV+PAGHPVAINASSDLNLIGFGINA+
Sbjct  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
Query  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            NN+RNFLAGEEDNVISQ++RPVKELAFPGSS EVDRLL NQKQS+FANAQPLQ E
Sbjct  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 5. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 375.8 bits 1621,  Expect = 3e-105
 Identities = 247/409 60%, Positives = 329/409 80%, Gaps = 8/409 1%
Query  1    SRSD---QENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHT 57
            SRSD   Q NP+ F SNRFQT Y N NG+IR+L++F++R+  +ENLQNYR++E++SKP+T
Sbjct  175  SRSDSRRQRNPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNT 234
Query  58   LFLPQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDL 117
            L LP+++DADFILVVL+G+A +T++N + R  +NLE+GD ++LPAGT +Y+ N DDN++L
Sbjct  235  LILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNL 294
Query  118  RVLDLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQE-Q 176
            RV  LAIP+NNPG+L  F  S T++Q S++SGF+K+ LEA FNT YEEIE+VLL D E Q
Sbjct  295  RVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQ 354
Query  177  EPQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIY 236
            E + +R  R + Q    E VIV+VS++QI+EL K+A+SSS +   SES PFNLRS  PIY
Sbjct  355  ENEKQR--RGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSESGPFNLRSNKPIY 412
Query  237  SNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELV 296
            SNKFG F+EITP+ NPQ+QDL+I +   EI EG+LLLP+YNS+AI IV V+EG+G +ELV
Sbjct  413  SNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELV 472
Query  297  GQRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFG 356
            G R+  Q+ + D++EE+ E+   +V+RY  KLS GDVF++PAGHP++INASS+L L+GFG
Sbjct  473  GIRD--QQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASSNLRLLGFG 530
Query  357  INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQ 413
            INA  NQRNFLAG EDNVI Q+ R VKEL FPGS  +V+RL+ NQ+QS+FANAQP Q
Sbjct  531  INANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQ 587

Sequence Alignment: 6. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 275.0 bits 1179,  Expect = 6e-75
 Identities = 226/399 56%, Positives = 338/399 84%, Gaps = 15/399 3%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            R   +NPF F S RFQT+++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP+TL+LP
Sbjct  143  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 202
Query  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
            ++ DAD+++V+L+G A+LT++N++DR+S+NL+ GD +++PAGT  Y+ N D++E+LR++ 
Sbjct  203  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMIT 262
Query  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
            LAIPVN PG++ESF+LS TQ Q S+L GF+K+ILEA+++T +EEI KVL+  +E + Q  
Sbjct  263  LAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGE 322
Query  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
              L        +E+VIV++S++QI+ELSK+AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  323  ERL--------QESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 374
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
            K+FEITPEKNPQL+DLD+F++ V++ EG+L+LP++NS+AIV++ +NEG+   ELVG + +
Sbjct  375  KLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQ 434
Query  302  NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKN 361
             QR       +Q+EE   +V++YRA+LS  D+FV+PAG+PV +NA+SDLN+  FGINA+N
Sbjct  435  QQR-------QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAEN 487
Query  362  NQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            NQRNFLAG +DNVISQI   V+ELAFPGS+++++ L+ +Q +S+F +AQP Q E
Sbjct  488  NQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKE 541

Sequence Alignment: 7. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 272.1 bits 1166,  Expect = 4e-74
 Identities = 236/397 59%, Positives = 330/397 83%, Gaps = 15/397 3%
Query  5    QENPFIFKSNR-FQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            + NPF F S+R F+T++ N+ GH+R+LQ+FD+RSK  +NL+NYR++E  SKP+TL+LP++
Sbjct  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
Query  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DADF+LVVL+G+AVLT++N + R+S  LE+G   K+PAGT  +L N DDNE+LR++ LA
Sbjct  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
Query  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
            +PVNNP +++ F+LS T+ Q S+L GF+K+ILEA+F++D +EI +VL+ ++ Q+ Q+   
Sbjct  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG-- 220
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKF 243
                 QE  +E VIV++ REQI+EL+K+AKSSSKKS+SSE +PFNLR++ PIYSNK+G++
Sbjct  221  -----QESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRW 275
Query  244  FEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQ 303
            FEITPEKNPQL+DLD+F+ SV++KEGSLLLP+YNS+AIVI+ +NEGK   ELVGQR E Q
Sbjct  276  FEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQR-EQQ 334
Query  304  REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQ 363
            +++    EEQEE  S +VQRYRA+LS  DVF++PA +PVAINA+S+LN+  FGINA+NNQ
Sbjct  335  KQQ----EEQEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQ 388
Query  364  RNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            RNFLAGE+DNVIS+I   V ++ FP S  +V +L+  Q +S+F +AQP Q E
Sbjct  389  RNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQE 440

Sequence Alignment: 8. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 268.9 bits 1152,  Expect = 3e-73
 Identities = 225/390 57%, Positives = 331/390 84%, Gaps = 20/390 5%
Query  5    QENPFIFKSNR-FQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            Q NPF F S+R F+T+++N+ GH+R++++FD+RSK  +NL+NYR++E+KSKP+TL+LP++
Sbjct  41   QNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH 100
Query  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DADF+LVVL+G+A+LT++N + R+S+ LE+G   K+PAGT  +L N +DN++LR++ LA
Sbjct  101  ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLA 160
Query  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
            IPVNNP ++++F+LS T+ Q S+L GF+K+ILEA+F++D++EI++VL+ ++ Q+ QH   
Sbjct  161  IPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ-QHG-- 217
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKF 243
                 +E  +E VIV++ REQI+EL K+AKSSS+K +SS+ EPFNLR+ NPIYSNKFG++
Sbjct  218  -----EESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRW 272
Query  244  FEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQ 303
            +EITPEKNPQL+DLD+F++SV++KEG LLLP+YNS+AIVI+ +NEG+   ELVG      
Sbjct  273  YEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP----- 327
Query  304  REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQ 363
                 D+++Q+E  S +VQRYRA+LS  DVFV+PA +PVAINA+S+LN+  FGINA+NNQ
Sbjct  328  ----SDQQQQDE--SLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQ 381
Query  364  RNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQ 413
            RNFLAGE+DNV+S+I   V +++FP S  +V++L+  Q +SHF +AQP Q
Sbjct  382  RNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQ 431

Sequence Alignment: 9. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 269.1 bits 1153,  Expect = 4e-73
 Identities = 225/399 56%, Positives = 334/399 83%, Gaps = 15/399 3%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            R   +NPF+F SNRF+T+++N+ G IR+LQ+F++RS  ++NL++YR+LE+ SKP+TL+LP
Sbjct  127  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 186
Query  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
             + DAD+++V+L+G A+L+++N++DR+S+ L+ GD +++P+GT  Y+ N D+NE+LR++ 
Sbjct  187  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 246
Query  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
            LAIPVN PG++ESF+LS T+ Q S+L GF+++ILEA+++T +EEI KVL+  +E + Q  
Sbjct  247  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 306
Query  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
            + L        +E+VIV++S+EQI+ LSK AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  307  QRL--------QESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 358
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
            KFFEITPEKNPQL+DLDIF++ V++ EG+LLLP++NS+AIVI+ +NEG    ELVG + +
Sbjct  359  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 418
Query  302  NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKN 361
             Q       E+Q+EE   +V++YRA+LS  D+FV+PAG+PV +NA+S+LN+   GINA+N
Sbjct  419  QQ-------EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 471
Query  362  NQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            NQRNFLAG +DNVISQI   V+ELAFPGS++ V++LL NQ++S+F +AQP + E
Sbjct  472  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 525

Sequence Alignment: 10. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 269.1 bits 1153,  Expect = 4e-73
 Identities = 225/399 56%, Positives = 334/399 83%, Gaps = 15/399 3%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            R   +NPF+F SNRF+T+++N+ G IR+LQ+F++RS  ++NL++YR+LE+ SKP+TL+LP
Sbjct  189  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 248
Query  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
             + DAD+++V+L+G A+L+++N++DR+S+ L+ GD +++P+GT  Y+ N D+NE+LR++ 
Sbjct  249  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 308
Query  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
            LAIPVN PG++ESF+LS T+ Q S+L GF+++ILEA+++T +EEI KVL+  +E + Q  
Sbjct  309  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 368
Query  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
            + L        +E+VIV++S+EQI+ LSK AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  369  QRL--------QESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
            KFFEITPEKNPQL+DLDIF++ V++ EG+LLLP++NS+AIVI+ +NEG    ELVG + +
Sbjct  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 480
Query  302  NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKN 361
             Q       E+Q+EE   +V++YRA+LS  D+FV+PAG+PV +NA+S+LN+   GINA+N
Sbjct  481  QQ-------EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 533
Query  362  NQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            NQRNFLAG +DNVISQI   V+ELAFPGS++ V++LL NQ++S+F +AQP + E
Sbjct  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 587

Sequence Alignment: 11. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 249.0 bits 1065,  Expect = 5e-67
 Identities = 224/408 54%, Positives = 320/408 78%, Gaps = 12/408 2%
Query  3    SDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQ 62
            + + NPF F S RF T Y N+NG IR+LQ+FD+RS+ F+NLQN+R+++ ++KP+TL LP+
Sbjct  169  TSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPK 228
Query  63   YTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDL 122
            + DAD ILV+  G+A +TV N N+R SFNL+ G  +++P+G I+Y+ NR DN++LRV  +
Sbjct  229  HADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKI 288
Query  123  AIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQ---EQEPQ 179
            ++PVN PGQ+E F+ + +++Q S+L GF+++ LEAAFN ++ EI +VLLE+    EQE +
Sbjct  289  SMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEER 348
Query  180  HRRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE---PFNLRSRNPIY 236
             +R    R  E N E VIVKVS+E+++EL+K+AKS SKK    E +   P NLR   P  
Sbjct  349  GQRRWSTRSSE-NNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDL 407
Query  237  SNKFGKFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFEL 295
            SN FGK+FE+ P+K NPQLQDLD+ +  VEIKEG+L+LP++NS+A+VIV VN+G G +EL
Sbjct  408  SNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLEL 467
Query  296  VGQRNENQ----REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLN 351
            V  R E Q    REE +DE+E+EE ++ +V+RY A+L  GDVF++PA HPVAINASS+L+
Sbjct  468  VAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSELH 527
Query  352  LIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQP 411
            L+GFGINA+NN+R FLAG++DNVI QI++  K+LAFPGS  +V++L+ NQK+SHF +A+P
Sbjct  528  LLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARP 587

Sequence Alignment: 12. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 248.3 bits 1062,  Expect = 7e-67
 Identities = 221/405 54%, Positives = 320/405 79%, Gaps = 19/405 4%
Query  3    SDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQ 62
            + + NPF F S RF T Y N+NG IR+LQ+FD+RSK F+NLQN+R+++ +++P+TL LP+
Sbjct  163  TSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPK 222
Query  63   YTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDL 122
            + DAD ILV+  G+A +TV N N+R SFNL+ G  +++P+G I+Y+ NR DN++LRV  +
Sbjct  223  HADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKI 282
Query  123  AIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLED-----QEQE 177
            ++PVN PGQ+E F+ + +++Q S+L GF+++ LEAAFN ++ EI +VLLE+     QE+ 
Sbjct  283  SMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEER 342
Query  178  PQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSE--SEPFNLRSRNPI 235
             Q RRS R      + E VIVKVS+E+++EL+K+AKS SKK    E  + P NLR   P 
Sbjct  343  GQRRRSTRSS----DNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPD 398
Query  236  YSNKFGKFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFE 294
             SN FG++FE+ P+K NPQLQDLD+ +  VEIKEG+L+LP++NS+A+VIV VN+G G +E
Sbjct  399  LSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLE 458
Query  295  LVGQRNENQ----RE---ENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINAS 347
            LV  R E Q    RE   E ++E+E+EE ++ +V+RY A+L  GDVF++PA HPVAINAS
Sbjct  459  LVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINAS 518
Query  348  SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFA 407
            S+L+L+GFGINA+NN+R FLAG++DNVI QI++  K+LAFPGS  +V++L+ NQ++SHF 
Sbjct  519  SELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFV 578
Query  408  NAQP 411
            +A+P
Sbjct  579  SARP 582

Sequence Alignment: 13. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 206.8 bits 880,  Expect = 2e-54
 Identities = 223/398 56%, Positives = 337/398 84%, Gaps = 35/398 8%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            R   +NPF F S RFQT+++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP+TL+LP
Sbjct  205  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 264
Query  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGT---------------IA 106
            ++ DAD+++V+L+G A+LT++N++DR+S+NL+ GD +++PAGT               IA
Sbjct  265  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIA 324
Query  107  ----YLANRDDNEDLRVLDLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTD 162
                Y+ N D++E+LR++ LAIPVN PG++ESF+LS TQ Q S+L GF+K+ILEA+++T 
Sbjct  325  GTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTK 384
Query  163  YEEIEKVLLEDQEQEPQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSS 222
            +EEI KVL+  +E + Q    L        +E+VIV++S++QI+ELSK+AKSSS+K++SS
Sbjct  385  FEEINKVLFGREEGQQQGEERL--------QESVIVEISKKQIRELSKHAKSSSRKTISS 436
Query  223  ESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIV 282
            E +PFNL SR+PIYSNK+GK+FEIT ++NPQL+DLD+F++ V++ EG+L+LP++NS+AIV
Sbjct  437  EDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIV 495
Query  283  IVTVNEGKGYFELVGQRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPV 342
            ++ +NEG+   ELVG + + QR       +Q+EE   +V++YRA+LS  D+FV+PAG+PV
Sbjct  496  VLVINEGEANIELVGIKEQQQR-------QQQEEQPLEVRKYRAELSEQDIFVIPAGYPV 548
Query  343  AINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQK 402
             +NA+SDLN+  FGINA+NNQRNFLAG +DNVISQI   V+ELAFP S+++++ L+ +Q 
Sbjct  549  MVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQS 608
Query  403  QSHFANAQPLQIE 415
            +S+F +AQP Q E
Sbjct  609  ESYFVDAQPQQKE 621

Sequence Alignment: 14. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 195.6 bits 829,  Expect = 2e-51
 Identities = 124/200 62%, Positives = 168/200 84%, Gaps = 7/200 3%
Query  209  SKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKE 268
            SK AKSSS+K++SSE +PFNL SR+PIYS K+GKFFEITPEKNPQL+DLDIF++ V++ E
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  269  GSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQEEETSTQVQRYRAKL 328
            G+LLLP++NS+AIVI+ +NEG    ELVG + + Q       E+Q+EE   +V++YRA+L
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ-------EQQQEEQPLEVRKYRAEL 113
Query  329  SPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFP 388
            S  D+FV+PAG+PV +NA+S+LN+   GINA+NNQRNFLAG +DNVISQI   V+ELAFP
Sbjct  114  SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFP 173
Query  389  GSSREVDRLLTNQKQSHFANAQPLQIE 415
            GS++ V++LL NQ++S+F +AQP + E
Sbjct  174  GSAQAVEKLLKNQRESYFVDAQPNEKE 200

Sequence Alignment: 15. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 159.3 bits 671,  Expect = 3e-40
 Identities = 233/394 59%, Positives = 334/394 84%, Gaps = 21/394 5%
Query  2    RSDQENPFIFKS-NRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            R D+ NPF F+S N FQT++EN+N  IRLLQ+F+KRS  +ENL++YR+++++SKP+T++L
Sbjct  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
Query  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            P++ DADF+L VLSG+A+LT++N++DR+S+NL  GD  ++PAGT  YL N  D+++L+++
Sbjct  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
Query  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
             LAIPVN PG+ + F+LS TQ Q S+L GF+ +ILE +F++++EEI +VL+ ++E++ Q 
Sbjct  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQ- 205
Query  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
                        +E VIV++S+EQI++LS+ AKSSS+K++SSE EPFNLRSRNPIYSN F
Sbjct  206  ------------QEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNF 253
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
            GKFFEITPEKNPQL+DLDIF++SV+I EG+LLLP++NS+AIVI+ +NEG    ELVG + 
Sbjct  254  GKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKE 313
Query  301  ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK 360
            + Q++      +QEEE   +VQRYRA+LS  DVFV+PA +P  +NA+S+LN++ FGINA+
Sbjct  314  QQQKQ------KQEEEP-LEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAE 366
Query  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415
            NNQRNFLAGE+DNV+ QI+R V+ELAFPGS+++V+RLL  Q++S+F +AQP Q E
Sbjct  367  NNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE 421

Sequence Alignment: 16. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 159.7 bits 673,  Expect = 4e-40
 Identities = 162/394 41%, Positives = 257/394 65%, Gaps = 26/394 6%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            +  + NP+ F    FQ  +  E+G+ R+LQ+F  +  ++  +  +R+   ++ P+T+ LP
Sbjct  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
Query  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
            ++ DA+ I VV +G+  +T +   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  
Sbjct  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
Query  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
            L  PVNNPGQ++ F+ +G +N  S+L  F++ ILEA FNT  E+++++        P  R
Sbjct  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDEL--------PGGR 347
Query  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
            +S   RRQ+   + +  K S+EQI+ LS+ A  +S +   SE   FNL S+ P YSN+ G
Sbjct  348  QS--HRRQQ--GQGMFRKASQEQIRALSQGA--TSPRGKGSEGYAFNLLSQTPRYSNQNG 401
Query  242  KFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
            +F+E  P     QL+++D  V + EI +GS+++P+YNS+A  +V V EG G+ E+V    
Sbjct  402  RFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHL 461
Query  301  ENQ------REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASS--DLNL 352
              Q      REE + EE++ E  S Q +R RA+LS G++FVVPAGHPV   AS   DL L
Sbjct  462  SRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGL 521
Query  353  IGFGI-NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQ-SHFANAQ 410
            +GFG+ N ++N+R F+AG+ +NV  Q  R  KELAF   SR VD ++ N  Q S+F + +
Sbjct  522  LGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGR 580

Sequence Alignment: 17. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 156.5 bits 659,  Expect = 3e-39
 Identities = 166/389 42%, Positives = 253/389 65%, Gaps = 29/389 7%
Query  7    NPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDA 66
            NPF F    FQ+ +  E+G+ R+LQ+F  R  I+  +  +RL   ++ P+T+ LP++ DA
Sbjct  180  NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA 239
Query  67   DFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPV 126
            + I +V +G+  LT L   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  L  PV
Sbjct  240  EKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV 299
Query  127  NNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLRD 186
            NNP Q+E F+ +G+Q   S+L  F++ ILE AFNT  E++++++   Q     HRR    
Sbjct  300  NNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQ----SHRRQ--- 352
Query  187  RRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEI 246
                   + +  K S+EQI+ LS+ A S  +K  S E   FNL  R P YSN+ G+F+E 
Sbjct  353  -----QGQGMFRKASQEQIRALSQEATSPREK--SGERFAFNLLYRTPRYSNQNGRFYEA 405
Query  247  TPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVG-----QRNE 301
             P +  QL D+++ V+++++ +GS+++P+YNS+A  +V VNEG GY E+V      Q + 
Sbjct  406  CPREFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSF 465
Query  302  NQREENDDEEEQEEET-STQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFG-- 356
             + EE   E+EQEEE  S Q ++ R++LS GD+FVVPA  PV   AS + NL   GFG  
Sbjct  466  EEEEEQQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLY 525
Query  357  ---INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQ-SHFANAQ 410
               IN  +NQR F+AG+ ++V  Q     KELAF  SSR VD ++ N  Q S+F + Q
Sbjct  526  NQNINPDHNQRIFVAGKINHV-RQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQ 582

Sequence Alignment: 18. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 114.8 bits 476,  Expect = 1e-26
 Identities = 156/382 40%, Positives = 243/382 63%, Gaps = 25/382 6%
Query  6    ENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTD 65
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+ + LP + D
Sbjct  208  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 267
Query  66   ADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
            AD IL+V+ G+  L +++ ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  268  ADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 327
Query  126  VNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLR 185
            ++ PGQ + F+ +G QN   +LS F+K ILEAA+NT  E +  VL        Q+R    
Sbjct  328  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVL-------GQQR---- 376
Query  186  DRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE----PFNLRSRNPIYSNKFG 241
                    E VI++ S+EQI+EL+++   S +  +    E    P+NL ++ P+YSNK+G
Sbjct  377  --------EGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 428
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
            + +E+ PE   QLQD+D+ V    I +GS++ P +N+R+  +V V  G+   E+      
Sbjct  429  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 488
Query  302  NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLI--GFGINA 359
             +       + +EEE   + ++ RA+LS  +  VV AGHPV   +S + NL+   FGINA
Sbjct  489  GRHGGRGGGKRHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINA 548
Query  360  KNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
            +NN+ NFLAG E NV+ QI+    ELAF  S +EV+ L+ +Q +S F
Sbjct  549  QNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIF 595

Sequence Alignment: 19. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 113.5 bits 470,  Expect = 2e-26
 Identities = 153/371 41%, Positives = 243/371 65%, Gaps = 38/371 10%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            +  +ENP++F+   F++  + E G +++L+ F KRS+++  ++N+RL   ++ PHT+  P
Sbjct  55   KEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
Query  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
             + DA+++L V  G+A +T++    R SFN+E GD I++PAGT  Y+ NRD+NE L ++ 
Sbjct  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
Query  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
            +  PV+ PG++E+F  +G ++  SF   F+  +LEAA+    E++EKV+ E      Q +
Sbjct  175  ILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGE------QSK 228
Query  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKK-SVSSESE-PFNLRSRNPIYSNK 239
             S             IVK SRE+I+ LS++ +   +      ES  P NL  ++P  SN+
Sbjct  229  GS-------------IVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQ 275
Query  240  FGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQR 299
            FG+++E  P+ + QLQDLD+ V+   I +GS+  P YNSRA  I  V EG+G+FE+    
Sbjct  276  FGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPH 335
Query  300  NENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGI 357
              +              +S   Q+  A+L  G VFV PAGHPVA+ AS + NL  + F +
Sbjct  336  LSS--------------SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEV 381
Query  358  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
            NA  N R  LAG+  N++++ +R  KELAF   SREV+R++ NQ Q+ F
Sbjct  382  NAHGNSRFPLAGK-GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFF 429

Sequence Alignment: 20. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 113.6 bits 471,  Expect = 3e-26
 Identities = 154/382 40%, Positives = 240/382 62%, Gaps = 25/382 6%
Query  6    ENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTD 65
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+ + LP + D
Sbjct  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
Query  66   ADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
            AD IL+V  G+  L +++ ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
Query  126  VNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLR 185
            ++ PGQ + F+ +G QN   +LS F+K ILEAA+NT  E +  VL        Q+R    
Sbjct  369  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-------GQQR---- 417
Query  186  DRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE----PFNLRSRNPIYSNKFG 241
                    E VI+  S+EQI+EL+++   S +  +    E    P+NL ++ P+YSNK+G
Sbjct  418  --------EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 469
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
            + +E+ PE   QLQD+D+ V    I +GS++ P +N+R+  +V V  G+   E+      
Sbjct  470  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 529
Query  302  NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLI--GFGINA 359
             +       + +EEE   + ++ +A+LS  +  VVP GHPV   +S + NL+   FGINA
Sbjct  530  GRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINA 589
Query  360  KNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
            +NN+ NFLAG E NV+ QI+    ELAF    +EV+ L+ +Q +S F
Sbjct  590  QNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIF 636

Sequence Alignment: 21. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 109.9 bits 455,  Expect = 4e-25
 Identities = 165/384 42%, Positives = 270/384 70%, Gaps = 25/384 6%
Query  5    QENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
            + NP+ F S  +++ +E+  G ++ L++F +R++++  ++NYR++  ++ P+T+ LP + 
Sbjct  375  RHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHK 434
Query  65   DADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ ++VV  G+A LT ++   R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  435  DAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQ 494
Query  125  PVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSL 184
            PVNNPGQ+  +  +G Q+  S+L  F+  IL AA+NT  + +E+ +++ QEQ        
Sbjct  495  PVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLER-FFDQQEQ-------- 545
Query  185  RDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE--PFNLRSRNPIYSNKFGK 242
                    +E VI++ S+E+++ LS++A S+ ++     S   P +L+S+   YSN+FG+
Sbjct  546  --------REGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQ 597
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN-E 301
            FFE  PE++ QLQ++D++VN  EIK G++++P+YNS+A V+V V EG G FE+    +  
Sbjct  598  FFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVS 657
Query  302  NQREENDDEEEQEEETST--QVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGI 357
            +Q  E     EQEEE S+  Q Q+  A+L+ GD+FV+PAGHP+AI AS + NL  +GFGI
Sbjct  658  SQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGI 717
Query  358  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
            N KNNQRNFLAG+ +N+I+Q++R  KEL+F     E++ ++  Q +S+F
Sbjct  718  NGKNNQRNFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFERQVESYF 765

Sequence Alignment: 22. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 108.9 bits 450,  Expect = 6e-25
 Identities = 153/382 40%, Positives = 249/382 65%, Gaps = 30/382 7%
Query  4    DQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            ++ENP++F+   F+T    + G I++L+KF KRSK++  ++N+R+   ++ P+T+  P +
Sbjct  96   EEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQTFISPAH 155
Query  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DA++++ V  G+A +T +    R +FN+E+GD +++PAGT  YL NRD+NE L ++ + 
Sbjct  156  FDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENEKLYIVKIL 215
Query  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
             PV+ PG++E+F  SG ++  SF   F+  +LEAA+ T  +++EK L+  Q Q       
Sbjct  216  RPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEK-LFGKQTQ------- 267
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSK--KSVSSESEPFNLRSRNPIYSNKFG 241
                        VI+K S+EQI+ +SK+ +++ +        + PFNL  + P  SN+FG
Sbjct  268  -----------GVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQFG 316
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELV----- 296
            ++FE  P++  QLQDLD+ V+   I +GS+  P YNSRA  I  V EG+GYFE+      
Sbjct  317  RLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLS 376
Query  297  GQRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IG 354
               +  QRE       +   +    Q+ R +L PG VFV PAGHPVA+ AS + NL  + 
Sbjct  377  SSGSRGQRE-GSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLC 435
Query  355  FGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
            F +NA+ N R  LAG+ +N++++ ++  KELAF   +REV++++ NQ Q  F
Sbjct  436  FDVNAQGNIRFPLAGK-NNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFF 486

Sequence Alignment: 23. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 108.4 bits 448,  Expect = 7e-25
 Identities = 163/384 42%, Positives = 272/384 70%, Gaps = 24/384 6%
Query  5    QENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
            + NP+ F S   ++ +E+E G ++ L++F +R++++  ++NYR++   + P+T+ LP++ 
Sbjct  66   RHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPHHK 125
Query  65   DADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ ++VV  G+A LT+++   R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  126  DAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQ 185
Query  125  PVNNPGQLESFLLSGTQN-QPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
            PVNNPGQ+  +  +G ++   S+L  F+  IL AA+NT  + +E+ +++ QEQ       
Sbjct  186  PVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQ------- 237
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE--PFNLRSRNPIYSNKFG 241
                     +E VI++ S+E+++ LS++A S+ ++     S   P +L+S  P YSN+FG
Sbjct  238  ---------REGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFG 288
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
            +FFE  PE++ QLQ++D++VN  EIK G++++P+YNS+A V+V V EG G +E+      
Sbjct  289  QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVS 348
Query  302  NQREENDDEEEQEEETST-QVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGIN 358
            +Q  E+    EQEEE ST + Q+  A+L+ GD+FV+PAGHP+AI AS + NL  +GFGIN
Sbjct  349  SQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGIN 408
Query  359  AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
             +NNQRNFLAG+ +++I+Q++R  KEL+F     E++ ++ +Q +S+F
Sbjct  409  GENNQRNFLAGQ-NSIINQLEREAKELSFNMPREEIEEIFESQMESYF 455

Sequence Alignment: 24. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 107.0 bits 442,  Expect = 2e-24
 Identities = 162/384 42%, Positives = 269/384 70%, Gaps = 24/384 6%
Query  5    QENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
            + NP+ F S   ++ +E+E G ++ L++F +R++++  ++NYR++   + P+T  LP++ 
Sbjct  178  RHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHK 237
Query  65   DADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ + VV  G+A LT+++   R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  238  DAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQ 297
Query  125  PVNNPGQLESFLLSGTQN-QPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
            PVNNPGQ+  +  +G ++   S+L  F+  IL AA+NT  + +E+ +++ QEQ       
Sbjct  298  PVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQ------- 349
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE--PFNLRSRNPIYSNKFG 241
                     +E VI++ S+E+++ LS++A S+ ++     S   P +L+S +P YSN+FG
Sbjct  350  ---------REGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG 400
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
            +FFE  PE++ QLQ++D++VN  EIK G++++P+YNS+A V+V V EG G +E+      
Sbjct  401  QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVS 460
Query  302  NQREENDDEEEQEEETST-QVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGIN 358
            +Q  E     EQEEE ST + Q+  A+L+ GD+FV+PAGHP+AI AS + NL  +GF IN
Sbjct  461  SQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDIN 520
Query  359  AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
             +NNQR+FLAG+ +N+I+Q++R  KEL+F     E++ ++ +Q +S+F
Sbjct  521  GENNQRDFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFESQMESYF 567

Sequence Alignment: 25. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 105.9 bits 437,  Expect = 5e-24
 Identities = 135/375 36%, Positives = 236/375 62%, Gaps = 26/375 6%
Query  8    PFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDAD 67
            P++F+   F T +  ++G +R+LQKF  RS+++  ++NYR+   +++P+T+ +P + DA+
Sbjct  195  PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAE 254
Query  68   FILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVN 127
             ++ V  G+  ++++  + R S+N+++GD +K+ AGT AYL NRD+NE L +  L  PV+
Sbjct  255  SVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVS 314
Query  128  NPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLRDR 187
             PG++E F+ +G +N  SF+  F+  ILEAAFNT  + +++++        Q+R      
Sbjct  315  TPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIF-------GQQR------ 361
Query  188  RQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEIT 247
                  + VIVK S EQ++ +S++ +              N+  + P +SN++G++ E+ 
Sbjct  362  ------QGVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVD 415
Query  248  PEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQREEN 307
              +  QL+DLD+ V+   I +G++  P+YNS+A  I  V +G+GYFE+        R   
Sbjct  416  ASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSR--- 472
Query  308  DDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGINAKNNQRN 365
                + E       QR  ++L+ G V ++PAGHP    ASS+ NL  + F +NA NN++ 
Sbjct  473  -GSYQGETRGRPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKF 531
Query  366  FLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
             LAG   NV++Q++R  KELAF   +REV+ +  +Q++  F
Sbjct  532  PLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFF 571

Sequence Alignment: 26. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 103.6 bits 427,  Expect = 2e-23
 Identities = 142/377 37%, Positives = 224/377 59%, Gaps = 29/377 7%
Query  4    DQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            + ENP++F+   F T  + E G + +L KF KRSK++  L+ YRL    + P+ + +P +
Sbjct  124  EDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNH 183
Query  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+  +T +  N R S N+++GD I++ AGT  Y+ N D+NE L ++ L 
Sbjct  184  MDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLL 243
Query  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
             PVN PG+ E F   G +N  SF   F++ +LEAA+ T  +++EK L+E Q+        
Sbjct  244  QPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LFEKQD-------- 294
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGK 242
                      E  IVK S+EQI+ +S+  +  S    + +S   FNL  ++P  SN +G+
Sbjct  295  ----------EGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQ 344
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNEN 302
            +FE   +  P LQ+LDI V+ V I +G +  P YNSRA  I  V  G+G +E+      +
Sbjct  345  LFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSS 404
Query  303  QREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGINAK 360
             +         +E++    ++  + +    VFVVPAGHP    AS + NL  + F +NA+
Sbjct  405  SKNSG------QEKSGPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAE 458
Query  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
             N R  LAG++ N+I  +++  KELAF     EVD+++  Q +  F
Sbjct  459  GNIRYTLAGKK-NIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFF 503

Sequence Alignment: 27. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 101.3 bits 417,  Expect = 1e-22
 Identities = 137/372 36%, Positives = 218/372 58%, Gaps = 34/372 9%
Query  4    DQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            + ENP++F+   F T  + E G + LL KF ++SK++  L+ YRL    + P+ + +P +
Sbjct  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
Query  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+  +T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
Query  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
             PVN PG++E F   G +N  SF   F+  ILEAA+ T  + +EK L+E Q+Q       
Sbjct  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQ------- 319
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGK 242
                         I+K S+EQI+ +S+  +       + ES   F L  ++P  SNK+G+
Sbjct  320  -----------GTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 368
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNEN 302
            +FE      P L+ LD+ V+   I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  369  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 428
Query  303  QREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGINAK 360
             +            +    ++ RA++    VF+VPAGHP A  AS + NL  + F +NA+
Sbjct  429  SKS-----------SHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE 477
Query  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
             N R  LAG++ N+I  +++  KELAF     EVD+++  Q +  F
Sbjct  478  GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFF 522

Sequence Alignment: 28. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 101.1 bits 416,  Expect = 1e-22
 Identities = 136/372 36%, Positives = 218/372 58%, Gaps = 34/372 9%
Query  4    DQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            + ENP++F+   F T  + E G + LL KF ++SK++  L+ YRL    + P+ + +P +
Sbjct  146  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 205
Query  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+  +T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  206  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 265
Query  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
             PVN PG++E F   G +N  SF   F+  ILEAA+ T  + +EK L+E Q+Q       
Sbjct  266  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQ------- 317
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGK 242
                         I+K S+EQ++ +S+  +       + ES   F L  ++P  SNK+G+
Sbjct  318  -----------GTIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 366
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNEN 302
            +FE      P L+ LD+ V+   I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  367  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 426
Query  303  QREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGINAK 360
             +            +    ++ RA++    VF+VPAGHP A  AS + NL  + F +NA+
Sbjct  427  SKS-----------SHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE 475
Query  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406
             N R  LAG++ N+I  +++  KELAF     EVD+++  Q +  F
Sbjct  476  GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFF 520

Sequence Alignment: 29. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 94.3 bits 386,  Expect = 1e-20
 Identities = 133/375 35%, Positives = 220/375 58%, Gaps = 29/375 7%
Query  5    QENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
            +ENP++F S+RF+    +E G IR L  F + S+++E +  YR+   + KP+T+ LP+Y 
Sbjct  63   EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYI 122
Query  65   DADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA- 123
            DA +IL V  G+  +  +  N+     LE GD   +P+G   YL N DD+  LR+  L  
Sbjct  123  DAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR 182
Query  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
                  G+ E F ++G +N  +  S F+  +LEAAFNTD +++E ++         HRR 
Sbjct  183  TESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG 235
Query  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSES-EPFNLRSRNPIYSNKFGK 242
                        VI   + EQI+E+ +    S++ + +SE  +PFNLR++ P + N  G+
Sbjct  236  ------------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGR 283
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNEN 302
            F    P+ NP L  +D+ V    +  G++  P++N++A  I  V EG+G  E+       
Sbjct  284  FTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQ 343
Query  303  QREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSD--LNLIGFGINAK 360
            +   +   E   ++ +   +R RA+L  G V+VVPAGHP+   AS++  L ++ F IN  
Sbjct  344  EHGWSSPRERGHQDIN--YERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTS 401
Query  361  NNQRNFLAGEEDNVISQIQRPVKELAF--PGSSREVDRLLTNQK 402
             N+R FLAG+ +NV+  +++ V+ L+F  P    E++ +L  QK
Sbjct  402  GNEREFLAGK-NNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQK 443

Sequence Alignment: 30. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 71.0 bits 284,  Expect = 1e-13
 Identities = 110/371 29%, Positives = 195/371 52%, Gaps = 66/371 17%
Query  4    DQENP-FIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQ 62
            D+++P  +F  +    +++ + G +R+L+    R  IF   ++  +     +P +LF+PQ
Sbjct  29   DKKSPKSLFLMSNSTRVFKTDAGEMRVLKSHGGR--IF--YRHMHIGFISMEPKSLFVPQ 84
Query  63   YTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDL 122
            Y D+++I+ +  G+A L  +  ++     L+ GD   +P+G+  YL N  + + L V+  
Sbjct  85   YLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICS 144
Query  123  AIPVNNPG--QLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVL---------- 170
              P  + G   ++SF + G  N  S LSGF  +ILE AFN     +E+++          
Sbjct  145  IDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMF 204
Query  171  ---------------LEDQEQEPQHRRSLRDRRQEINKENVIVKVSREQIKE--LSKNAK 213
                           L+  ++E Q ++ ++D  QE ++E      S  ++ E  + K  +
Sbjct  205  VDDSHAPSLWTKFLQLKKDDKEQQLKKMMQD--QEEDEEEKQTSRSWRKLLETVFGKVNE 262
Query  214  SSSKKSVSSESEPFNLRS-RNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLL 272
                K  +     +NL   +   + N +G    +   + P L + DI V  V++  GS+L
Sbjct  263  KIENKDTAGSPASYNLYDDKKADFKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSML 322
Query  273  LPNYN--SRAIVIVTVNEGKGYFEL-VGQRNENQREENDDEEEQEEETSTQVQRYRAKLS 329
             P+ N  S    IV      GY EL +G  N ++                     + K+ 
Sbjct  323  APHVNPISDEYTIVL----SGYGELHIGYPNGSRA-------------------MKTKIK 359
Query  330  PGDVFVVPAGHPVAINASSD--LNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAF 387
             GDVFVVP   P    AS D  L + GF  +A+ N+  FLAG   +++  +  P    AF
Sbjct  360  QGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAA-SLLRTLMGPELSAAF 418
Query  388  PGSSREVDRLLTNQKQS 404
              S   + R +  Q ++
Sbjct  419  GVSEDTLRRAVDAQHEA 435

Sequence Alignment: 31. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 59.4 bits 233,  Expect = 4e-10
 Identities = 105/381 27%, Positives = 182/381 47%, Gaps = 58/381 15%
Query  6    ENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTD 65
            E+  +F   R + + + + G +RL+  +  R     N     +     +P+TL++PQY D
Sbjct  51   EDRGLFILRRSKEVLKTDAGEVRLMMGYRYRG----NHSPMHIGFITMEPNTLYIPQYID 106
Query  66   ADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL---DL 122
            A +IL V  G+A +  +  N      L+ G    +PAG+  Y+ N D +E L ++   D 
Sbjct  107  ASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDT 166
Query  123  AIPVNNPGQL-ESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVL----------- 170
               +   G   +SF + G     S LSGF+ S L AAFN   +++E +L           
Sbjct  167  LESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRL 226
Query  171  --------------LEDQEQEPQHRRSLRDRRQEINKENVIVKVSREQIKEL--SKNAKS 214
                          ++ +E+  Q +    D   E  +E   V   R  +K L    + + 
Sbjct  227  NGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRV 286
Query  215  SSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLP 274
              K  ++     +NL    P Y N +G    I       L+  ++ V  V +K G++L P
Sbjct  287  QRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSP 346
Query  275  NYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVF 334
            + N  A     +  G G  ++V                             AK+S GDVF
Sbjct  347  HVNPTATEYGIILRGSGTIQVV--------------------FPNGTAAMNAKVSEGDVF 386
Query  335  VVPAGHPVAINAS--SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSR 392
             +P   P    AS  + L + GF  +A+ N+  FL G+  +++  ++ P    AF  S  
Sbjct  387  WIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGK-SSLLHSMRGPELAAAFGVSEE 445
Query  393  EVDRLLTNQKQSHFANAQP 411
            +++R++  Q+++      P
Sbjct  446  QLERIVKAQREAVILPTSP 464

Sequence Alignment: 32. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 38.3 bits 140,  Expect = 0.0008
 Identities = 55/201 27%, Positives = 102/201 50%, Gaps = 35/201 17%
Query  139  GTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLRDRRQEINKENVIV 198
            G   + + ++GF++ +L  AFN + E I ++      Q PQ +R +  R   + +E  ++
Sbjct  166  GGSRRGNMFNGFDERLLADAFNVNPELIRRL------QRPQMQRGIIVR---VEEEFRVL 216
Query  199  KVSR--EQIKELSKNAKSSSKKSVSSESEPFNLR--SRNPIYSNKFGKFFEITPEKNPQL 254
               R  EQ +E  ++  +  +++  +     N+   SR  +Y+ + G+   +     P L
Sbjct  217  SPQRGQEQEQEQEQDCDNGVEETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVL 276
Query  255  QDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQE 314
            + L +      + + +L  P++N     IV +  G G  ++V   +EN    ND      
Sbjct  277  RWLQLSAEKGNLYQNALTSPHWNLNCHSIVYITRGSGRMQIV---SENG---ND------ 324
Query  315  EETSTQVQRYRAKLSPGDVFVVPAGHPVAINASS-DLNLIGFGINAKNNQRNFLAG 369
                     +  ++  G + V+P G  V   AS+  L  I F  N  N   N LAG
Sbjct  325  --------VFNGEIREGQLIVIPQGFAVVKKASNRGLEWIAFKTN-DNAMTNQLAG 371
 Score = 38.3 bits 140,  Expect = 0.0008
 Identities = 32/118 27%, Positives = 59/118 50%, Gaps = 6/118 5%
Query  245  EITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN-ENQ 303
            E   + NPQLQ  ++ V    I++  LL+P Y + A +   V +G+G    V     E  
Sbjct  6    EFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVV-QGRGIHGAVFPGCPETY 64
Query  304  REENDDEEEQEEETSTQVQRYRAK-LSPGDVFVVPAG--HPVAINASSDLNLIGF-GINA 359
            +++   +  Q + + +Q Q  + + +  GD+  +P G  H +  N  S L L+ +  +  
Sbjct  65   QDQQQQQSYQSQGSRSQDQHQKVRQIREGDIIALPTGAAHWIYNNGGSQLVLVALVDVGN 124
Query  360  KNNQ 363
             +NQ
Sbjct  125  SDNQ 128

Sequence Alignment: 33. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 35.5 bits 128,  Expect = 0.005
 Identities = 71/245 28%, Positives = 126/245 51%, Gaps = 70/245 28%
Query  92   LERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVNNPGQLESFL------------LSG 139
            +  GD I LP G+  ++ N   ++ L ++ L    N+  QL+ ++            L G
Sbjct  93   IREGDIIALPTGSAHWIYNNGQSQ-LVLVALVDVGNSDNQLDQYFRKFYLGGNPQPQLQG 151
Query  140  T-QNQ-----------------PSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
            T Q+Q                  + ++GF++ +L  AFN + E I ++      Q PQ +
Sbjct  152  TSQSQGGRYQERLGGGDSSRRSANIFNGFDERLLAEAFNVNPELIRRL------QRPQMQ 205
Query  182  RSLRDRRQEINKENVIVKVSREQIKELSK--NAKSSSKKSVSSESEPFNLR--SRNPIYS 237
            R +  R +E   E  ++   R Q    S      +  ++++ +     N+   SR  +Y+
Sbjct  206  RGIIIRVEE---EFRVLTPQRGQESYESDPYGRYNGVEETLCTMRLRHNINDPSRADVYN 262
Query  238  NKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVG 297
             + G+   +     P L+ L +      + + +L  P++N  A  IV +  G G  ++V 
Sbjct  263  PRAGRVTTVNRLNLPVLRWLQLSAEKGNLYKNALTAPHWNLNAHSIVYITRGNGRVQIVS 322
Query  298  QRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASS-DLNLIGFG 356
            +   N                     +  ++  G + VVP G  V   AS+  L  I F 
Sbjct  323  ENGNNV--------------------FDGEIREGQLIVVPQGFAVVKRASNRGLEWISFK 362
Query  357  IN--AKNNQRNFLAG 369
             N  A  NQ   LAG
Sbjct  363  TNDYAMTNQ---LAG 374

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.