The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL
PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL
DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH
RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF
GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN
ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE
NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE
Sequence Info Allergen Name Length Opt Bits Score E Value
CAF25232 Pis s 1.0101 415 2656 611.8 1.9e-176
CAF25233 Pis s 1.0102 415 2625 604.7 2.6e-174
CAD87731 Len c 1.0102 415 2459 566.9 6.4e-163
CAD87730 Len c 1.0101 418 2422 558.4 2.2e-160
ACB05815 Lup an 1.0101 611 1617 374.9 5.9e-105
Q9FZP9 Gly m 5.0201 559 1158 270.2 1.7e-73
B1NPN8 Vig r 2.0201 454 1141 266.4 2e-72
O22120 Gly m 5.0101 543 1140 266.1 2.8e-72
CAA35691 Gly m conglycinin 605 1140 266.1 3.2e-72
Q198W3 Vig r 2.0101 453 1123 262.3 3.3e-71
P43238 Ara h 1 626 1063 248.6 6.3e-67
P43237 Ara h 1 614 1038 242.9 3.2e-65
AAB01374 Gly m conglycinin 639 872 205.0 8.3e-54
AAA33947 Gly m conglycinin 218 829 195.6 2e-51
AAB23463 Gly m conglycinin 439 674 160.0 2.1e-40
P09799 Gos h 2 605 671 159.2 4.8e-40
P09801 Gos h 1 588 650 154.4 1.3e-38
AAL86739 Cor a 11 448 482 116.2 3.2e-27
Q9SPL3 Mac i 1.0101 625 479 115.4 7.5e-27
Q9SPL4 Mac i 1.0201 666 476 114.8 1.3e-26
A0A2I4E5L6 Jug r 6.0101 502 459 110.9 1.4e-25
B3STU4 Car i 2.0101 792 462 111.5 1.4e-25
AAM54366 Jug n 2 481 454 109.8 2.9e-25
AAF18269 Jug r 2 593 448 108.4 9.4e-25
AAK15089 Ses i 3 585 447 108.2 1.1e-24
EF116865 Pis v 3.0101 519 434 105.2 7.4e-24
AAM73729 Ana o 1.0102 536 414 100.7 1.8e-22
AAM73730 Ana o 1.0101 538 414 100.7 1.8e-22
V9VGU0 Pin k 2.0101 463 386 94.3 1.3e-20
BAB21619 Gly m Bd28K 473 269 67.6 1.4e-12
A0A0S3B0K0 Coc n 1.0101 490 235 59.9 3.1e-10
QYU76044 Zan b 2.02 383 142 38.7 0.00057
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 611.8 bits 2656,  Expect = 2e-176
 Identities = 415/415 100%, Positives = 415/415 100%, Gaps = 0/415 0%
Query  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL
Sbjct  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
Query  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
            PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
            DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH
Sbjct  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
Query  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
            RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF
Sbjct  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
            GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN
Sbjct  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
Query  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
            ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE
Sbjct  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
Query  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE
Sbjct  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 2. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 604.7 bits 2625,  Expect = 3e-174
 Identities = 411/415 99%, Positives = 411/415 99%, Gaps = 0/415 0%
Query  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKP TLFL
Sbjct  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFL 60
Query  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
            PQ TDADFILVVLSGKATLTVLKSNDRNSFNLERGD IKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
            DL IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH
Sbjct  121  DLTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
Query  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
            RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF
Sbjct  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
            GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN
Sbjct  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
Query  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
            ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE
Sbjct  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
Query  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE
Sbjct  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 3. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 566.9 bits 2459,  Expect = 6e-163
 Identities = 382/415 92%, Positives = 399/415 96%, Gaps = 0/415 0%
Query  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            SRSDQENPFIFKSNRFQT+YENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL
Sbjct  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
Query  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
            PQYTDADFILVVLSGKA LTVL SNDRNSFNLERGD IKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
            DLAIPVN PGQL+SFLLSGTQNQPS+LSGF+K+ILEAAFNT+YEEIEKVLLE QEQEPQH
Sbjct  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
Query  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
            RRSL+DRRQEIN+ENVIVKVSREQI+ELSKNAKSSSKKSVSSES PFNLRSRNPIYSNKF
Sbjct  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
            GKFFEITPEKN QLQDLDIFVNSV+IKEGSLLLPNYNSRAIVIVTV EGKG FELVGQRN
Sbjct  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
Query  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
            ENQ +END EEEQEEETS QVQ YRAKLSPGDVFV+PAGHPVAINASSDLNLIGFGINA+
Sbjct  301  ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK 360
Query  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            NN+RNFLAGEEDNVISQ++RPVKELAFPGSS EVDRLL NQKQS+FANAQPLQ E
Sbjct  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415

Sequence Alignment: 4. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 558.4 bits 2422,  Expect = 2e-160
 Identities = 377/415 90%, Positives = 399/415 96%, Gaps = 3/415 0%
Query  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            SRSDQENPFIFKSNRFQT+YENENGHIRLLQ+FDKRSKIFENLQNYRLLEYKSKPHT+FL
Sbjct  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
Query  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
            PQ+TDADFILVVLSGKA LTVL SNDRNSFNLERGD IKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
            DLAIPVN+PGQLQSFLLSGTQNQPS+LSGFSKNILEAAFNT YEEIEKVLLE+QEQ+ QH
Sbjct  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH 180
Query  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
            RRSL+D+RQEI  E+VIVKVSREQIEELSKNAKSSSKKSVSSES PFNLRSRNPIYSNKF
Sbjct  181  RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
            GKFFEITPEKN QLQDLDIFVNSV+IKEGSLLLPNYNSRAIVIVTV EGKGDFELVGQRN
Sbjct  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN 300
Query  301  ENQGK---ENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGI 357
            ENQ +   END+EE QEEET+KQVQ YRA+LSPGDV+VIPAGHPVAINASSDLNLIGFGI
Sbjct  301  ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI 360
Query  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            NA+NN+RNFLAGEEDNVISQ++RPVKELAFPGSS EVDRLL NQKQS+FANAQPLQ E
Sbjct  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418

Sequence Alignment: 5. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 374.9 bits 1617,  Expect = 6e-105
 Identities = 249/409 60%, Positives = 331/409 80%, Gaps = 12/409 2%
Query  1    SRSD---QENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHT 57
            SRSD   Q NP+ F SNRFQT Y N NG+IR+L++F++R+  +ENLQNYR++E++SKP+T
Sbjct  175  SRSDSRRQRNPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNT 234
Query  58   LFLPQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDL 117
            L LP+++DADFILVVL+G+AT+T++  + R  +NLE+GDA++LPAGT +Y+ N DDN++L
Sbjct  235  LILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNL 294
Query  118  RVLDLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLL---EQQ 174
            RV  LAIP+N PG+L  F  S T++Q S +SGFSKN LEA FNT YEEIE+VLL   E Q
Sbjct  295  RVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQ 354
Query  175  EQEPQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNP 234
            E E Q R     + Q   +E VIV+VS++QI+EL K+A+SSS +   SESGPFNLRS  P
Sbjct  355  ENEKQRR----GQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSESGPFNLRSNKP 410
Query  235  IYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFE 294
            IYSNKFG F+EITP+ N Q+QDL+I +   +I EG+LLLP+YNS+AI IV V EG+G++E
Sbjct  411  IYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYE 470
Query  295  LVGQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIG 354
            LVG R  +Q ++ D++EE+ E+  ++V+ Y  KLS GDVF+IPAGHP++INASS+L L+G
Sbjct  471  LVGIR--DQQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASSNLRLLG 528
Query  355  FGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQR 414
            FGINA  N+RNFLAG EDNVI Q++R VKEL FPGS  +V+RL+KNQ+QSYFANAQP Q+
Sbjct  529  FGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQ 588
Query  415  E 415
            +
Sbjct  589  Q 589

Sequence Alignment: 6. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 270.2 bits 1158,  Expect = 2e-73
 Identities = 229/399 57%, Positives = 334/399 83%, Gaps = 15/399 3%
Query  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            R   +NPF F S RFQTL++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP+TL+LP
Sbjct  143  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 202
Query  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
            ++ DAD+++V+L+G A LT++ ++DR+S+NL+ GDA+++PAGT  Y+ N D++E+LR++ 
Sbjct  203  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMIT 262
Query  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
            LAIPVNKPG+++SF+LS TQ Q S L GFSKNILEA+++T +EEI KVL+ ++E + Q  
Sbjct  263  LAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGE 322
Query  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
              L+        E+VIV++S++QI ELSK+AKSSS+K++SSE  PFNLRSR+PIYSNK+G
Sbjct  323  ERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 374
Query  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
            K+FEITPEKN QL+DLD+F++ VD+ EG+L+LP++NS+AIV++ + EG+ + ELVG + +
Sbjct  375  KLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQ 434
Query  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAEN 361
             Q        +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+SDLN+  FGINAEN
Sbjct  435  QQ-------RQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAEN 487
Query  362  NERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            N+RNFLAG +DNVISQ+   V+ELAFPGS+ +++ L+K+Q +SYF +AQP Q+E
Sbjct  488  NQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKE 541

Sequence Alignment: 7. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 266.4 bits 1141,  Expect = 2e-72
 Identities = 234/397 58%, Positives = 323/397 81%, Gaps = 15/397 3%
Query  5    QENPFIFKSNR-FQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            + NPF F S+R F+TL+ N+ GH+R+LQ+FD+RSK  +NL+NYR++E  SKP+TL+LP++
Sbjct  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
Query  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DADF+LVVL+G+A LT++  + R+S  LE+G A K+PAGT  +L N DDNE+LR++ LA
Sbjct  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
Query  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
            +PVN P ++Q F+LS T+ Q S L GFSKNILEA+F+++ +EI +VL+ ++ Q+ Q+   
Sbjct  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG-- 220
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKF 243
                 QE  +E VIV++ REQI EL+K+AKSSSKKS+SSE  PFNLR++ PIYSNK+G++
Sbjct  221  -----QESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRW 275
Query  244  FEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQ 303
            FEITPEKN QL+DLD+F+ SVD+KEGSLLLP+YNS+AIVI+ + EGK + ELVGQR + +
Sbjct  276  FEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQK 335
Query  304  GKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNE 363
                 ++EEQEE  S +VQ YRA+LS  DVF+IPA +PVAINA+S+LN+  FGINAENN+
Sbjct  336  -----QQEEQEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQ 388
Query  364  RNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            RNFLAGE+DNVIS++   V ++ FP S  +V +L+K Q +S F +AQP Q+E
Sbjct  389  RNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQE 440

Sequence Alignment: 8. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 266.1 bits 1140,  Expect = 3e-72
 Identities = 229/399 57%, Positives = 332/399 83%, Gaps = 15/399 3%
Query  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            R   +NPF+F SNRF+TL++N+ G IR+LQ+F++RS  ++NL++YR+LE+ SKP+TL+LP
Sbjct  127  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 186
Query  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
             + DAD+++V+L+G A L+++ ++DR+S+ L+ GDA+++P+GT  Y+ N D+NE+LR++ 
Sbjct  187  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 246
Query  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
            LAIPVNKPG+++SF+LS T+ Q S L GFS+NILEA+++T +EEI KVL+ ++E + Q  
Sbjct  247  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 306
Query  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
            + L+        E+VIV++S+EQI  LSK AKSSS+K++SSE  PFNLRSR+PIYSNK+G
Sbjct  307  QRLQ--------ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 358
Query  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
            KFFEITPEKN QL+DLDIF++ VD+ EG+LLLP++NS+AIVI+ + EG  + ELVG + +
Sbjct  359  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 418
Query  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAEN 361
             Q       E+Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN+   GINAEN
Sbjct  419  QQ-------EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 471
Query  362  NERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            N+RNFLAG +DNVISQ+   V+ELAFPGS++ V++LLKNQ++SYF +AQP ++E
Sbjct  472  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 525

Sequence Alignment: 9. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 266.1 bits 1140,  Expect = 3e-72
 Identities = 229/399 57%, Positives = 332/399 83%, Gaps = 15/399 3%
Query  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            R   +NPF+F SNRF+TL++N+ G IR+LQ+F++RS  ++NL++YR+LE+ SKP+TL+LP
Sbjct  189  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 248
Query  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
             + DAD+++V+L+G A L+++ ++DR+S+ L+ GDA+++P+GT  Y+ N D+NE+LR++ 
Sbjct  249  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 308
Query  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
            LAIPVNKPG+++SF+LS T+ Q S L GFS+NILEA+++T +EEI KVL+ ++E + Q  
Sbjct  309  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 368
Query  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
            + L+        E+VIV++S+EQI  LSK AKSSS+K++SSE  PFNLRSR+PIYSNK+G
Sbjct  369  QRLQ--------ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
Query  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
            KFFEITPEKN QL+DLDIF++ VD+ EG+LLLP++NS+AIVI+ + EG  + ELVG + +
Sbjct  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 480
Query  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAEN 361
             Q       E+Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN+   GINAEN
Sbjct  481  QQ-------EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 533
Query  362  NERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            N+RNFLAG +DNVISQ+   V+ELAFPGS++ V++LLKNQ++SYF +AQP ++E
Sbjct  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 587

Sequence Alignment: 10. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 262.3 bits 1123,  Expect = 3e-71
 Identities = 223/392 56%, Positives = 326/392 83%, Gaps = 20/392 5%
Query  5    QENPFIFKSNR-FQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            Q NPF F S+R F+TL++N+ GH+R++++FD+RSK  +NL+NYR++E+KSKP+TL+LP++
Sbjct  41   QNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH 100
Query  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DADF+LVVL+G+A LT++  + R+S+ LE+G A K+PAGT  +L N +DN++LR++ LA
Sbjct  101  ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLA 160
Query  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
            IPVN P ++Q+F+LS T+ Q S L GFSKNILEA+F+++++EI++VL+ ++ Q+ QH   
Sbjct  161  IPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ-QHG-- 217
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKF 243
                 +E  EE VIV++ REQI EL K+AKSSS+K +SS+  PFNLR+ NPIYSNKFG++
Sbjct  218  -----EESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRW 272
Query  244  FEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQ 303
            +EITPEKN QL+DLD+F++SVD+KEG LLLP+YNS+AIVI+ + EG+   ELVG  ++  
Sbjct  273  YEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQ-- 330
Query  304  GKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNE 363
                     Q+++ S +VQ YRA+LS  DVFVIPA +PVAINA+S+LN+  FGINAENN+
Sbjct  331  ---------QQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQ 381
Query  364  RNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            RNFLAGE+DNV+S++   V +++FP S ++V++L+K Q +S+F +AQP Q++
Sbjct  382  RNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQ 433

Sequence Alignment: 11. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 248.6 bits 1063,  Expect = 6e-67
 Identities = 222/408 54%, Positives = 317/408 77%, Gaps = 12/408 2%
Query  3    SDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQ 62
            + + NPF F S RF T Y N+NG IR+LQ+FD+RS+ F+NLQN+R+++ ++KP+TL LP+
Sbjct  169  TSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPK 228
Query  63   YTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDL 122
            + DAD ILV+  G+AT+TV   N+R SFNL+ G A+++P+G I+Y+ NR DN++LRV  +
Sbjct  229  HADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKI 288
Query  123  AIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQ---EQEPQ 179
            ++PVN PGQ++ F+ + +++Q S L GFS+N LEAAFN  + EI +VLLE+    EQE +
Sbjct  289  SMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEER 348
Query  180  HRRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSE---SGPFNLRSRNPIY 236
             +R    R  E N E VIVKVS+E++EEL+K+AKS SKK    E   + P NLR   P  
Sbjct  349  GQRRWSTRSSE-NNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDL 407
Query  237  SNKFGKFFEITPEK-NQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFEL 295
            SN FGK+FE+ P+K N QLQDLD+ +  V+IKEG+L+LP++NS+A+VIV V +G G++EL
Sbjct  408  SNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLEL 467
Query  296  VGQRNENQ--GKENDKEEEQEEE--TSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLN 351
            V  R E Q  G+  ++E+E EEE  ++++V+ Y A+L  GDVF++PA HPVAINASS+L+
Sbjct  468  VAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSELH 527
Query  352  LIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQP 411
            L+GFGINAENN R FLAG++DNVI Q+E+  K+LAFPGS  +V++L+KNQK+S+F +A+P
Sbjct  528  LLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARP 587

Sequence Alignment: 12. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 242.9 bits 1038,  Expect = 3e-65
 Identities = 217/405 53%, Positives = 317/405 78%, Gaps = 19/405 4%
Query  3    SDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQ 62
            + + NPF F S RF T Y N+NG IR+LQ+FD+RSK F+NLQN+R+++ +++P+TL LP+
Sbjct  163  TSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPK 222
Query  63   YTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDL 122
            + DAD ILV+  G+AT+TV   N+R SFNL+ G A+++P+G I+Y+ NR DN++LRV  +
Sbjct  223  HADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKI 282
Query  123  AIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQ-----QEQE 177
            ++PVN PGQ++ F+ + +++Q S L GFS+N LEAAFN  + EI +VLLE+     QE+ 
Sbjct  283  SMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEER 342
Query  178  PQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSE--SGPFNLRSRNPI 235
             Q RRS +      + E VIVKVS+E+++EL+K+AKS SKK    E  + P NLR   P 
Sbjct  343  GQRRRSTRSS----DNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPD 398
Query  236  YSNKFGKFFEITPEK-NQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFE 294
             SN FG++FE+ P+K N QLQDLD+ +  V+IKEG+L+LP++NS+A+VIV V +G G++E
Sbjct  399  LSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLE 458
Query  295  LVGQRNENQGK-------ENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINAS 347
            LV  R E Q +       E ++E+E+EE ++++V+ Y A+L  GDVF++PA HPVAINAS
Sbjct  459  LVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINAS 518
Query  348  SDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFA 407
            S+L+L+GFGINAENN R FLAG++DNVI Q+E+  K+LAFPGS  +V++L+KNQ++S+F 
Sbjct  519  SELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFV 578
Query  408  NAQP 411
            +A+P
Sbjct  579  SARP 582

Sequence Alignment: 13. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 205.0 bits 872,  Expect = 8e-54
 Identities = 226/398 56%, Positives = 333/398 83%, Gaps = 35/398 8%
Query  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            R   +NPF F S RFQTL++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP+TL+LP
Sbjct  205  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 264
Query  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGT---------------IA 106
            ++ DAD+++V+L+G A LT++ ++DR+S+NL+ GDA+++PAGT               IA
Sbjct  265  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIA 324
Query  107  ----YLANRDDNEDLRVLDLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTN 162
                Y+ N D++E+LR++ LAIPVNKPG+++SF+LS TQ Q S L GFSKNILEA+++T 
Sbjct  325  GTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTK 384
Query  163  YEEIEKVLLEQQEQEPQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSS 222
            +EEI KVL+ ++E + Q    L+        E+VIV++S++QI ELSK+AKSSS+K++SS
Sbjct  385  FEEINKVLFGREEGQQQGEERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISS 436
Query  223  ESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIV 282
            E  PFNL SR+PIYSNK+GK+FEIT ++N QL+DLD+F++ VD+ EG+L+LP++NS+AIV
Sbjct  437  EDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIV 495
Query  283  IVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPV 342
            ++ + EG+ + ELVG + + Q        +Q+EE   +V+ YRA+LS  D+FVIPAG+PV
Sbjct  496  VLVINEGEANIELVGIKEQQQ-------RQQQEEQPLEVRKYRAELSEQDIFVIPAGYPV 548
Query  343  AINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQK 402
             +NA+SDLN+  FGINAENN+RNFLAG +DNVISQ+   V+ELAFP S+ +++ L+K+Q 
Sbjct  549  MVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQS 608
Query  403  QSYFANAQPLQRE 415
            +SYF +AQP Q+E
Sbjct  609  ESYFVDAQPQQKE 621

Sequence Alignment: 14. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 195.6 bits 829,  Expect = 2e-51
 Identities = 125/200 62%, Positives = 167/200 83%, Gaps = 7/200 3%
Query  209  SKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKE 268
            SK AKSSS+K++SSE  PFNL SR+PIYS K+GKFFEITPEKN QL+DLDIF++ VD+ E
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  269  GSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKL 328
            G+LLLP++NS+AIVI+ + EG  + ELVG + + Q       E+Q+EE   +V+ YRA+L
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ-------EQQQEEQPLEVRKYRAEL 113
Query  329  SPGDVFVIPAGHPVAINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFP 388
            S  D+FVIPAG+PV +NA+S+LN+   GINAENN+RNFLAG +DNVISQ+   V+ELAFP
Sbjct  114  SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFP 173
Query  389  GSSHEVDRLLKNQKQSYFANAQPLQRE 415
            GS++ V++LLKNQ++SYF +AQP ++E
Sbjct  174  GSAQAVEKLLKNQRESYFVDAQPNEKE 200

Sequence Alignment: 15. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 160.0 bits 674,  Expect = 2e-40
 Identities = 238/394 60%, Positives = 329/394 83%, Gaps = 21/394 5%
Query  2    RSDQENPFIFKS-NRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
            R D+ NPF F+S N FQTL+EN+N  IRLLQ+F+KRS  +ENL++YR+++++SKP+T++L
Sbjct  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
Query  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
            P++ DADF+L VLSG+A LT++ ++DR+S+NL  GDA ++PAGT  YL N  D+++L+++
Sbjct  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
Query  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
             LAIPVNKPG+   F+LS TQ Q S L GFS NILE +F++ +EEI +VL+ ++E++ Q 
Sbjct  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQ- 205
Query  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
                        +E VIV++S+EQI +LS+ AKSSS+K++SSE  PFNLRSRNPIYSN F
Sbjct  206  ------------QEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNF 253
Query  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
            GKFFEITPEKN QL+DLDIF++SVDI EG+LLLP++NS+AIVI+ + EG  + ELVG   
Sbjct  254  GKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGI-- 311
Query  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
                KE  ++++QEEE   +VQ YRA+LS  DVFVIPA +P  +NA+S+LN++ FGINAE
Sbjct  312  ----KEQQQKQKQEEEPL-EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAE 366
Query  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            NN+RNFLAGE+DNV+ Q+ER V+ELAFPGS+++V+RLLK Q++SYF +AQP Q+E
Sbjct  367  NNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE 421

Sequence Alignment: 16. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 159.2 bits 671,  Expect = 5e-40
 Identities = 163/394 41%, Positives = 258/394 65%, Gaps = 26/394 6%
Query  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            +  + NP+ F    FQ  +  E+G+ R+LQ+F  +  ++  +  +R+   ++ P+T+ LP
Sbjct  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
Query  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
            ++ DA+ I VV +G+ T+T +   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  
Sbjct  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
Query  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
            L  PVN PGQ+Q F+ +G +N  S L  FS+ ILEA FNT  E+++++        P  R
Sbjct  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDEL--------PGGR 347
Query  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
            +S   RRQ+   + +  K S+EQI  LS+ A  +S +   SE   FNL S+ P YSN+ G
Sbjct  348  QS--HRRQQ--GQGMFRKASQEQIRALSQGA--TSPRGKGSEGYAFNLLSQTPRYSNQNG 401
Query  242  KFFEITPEK-NQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVG--- 297
            +F+E  P    QQL+++D  V + +I +GS+++P+YNS+A  +V VTEG G  E+V    
Sbjct  402  RFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHL 461
Query  298  --QRNENQGKENDKEEEQE-EETSKQVQLYRAKLSPGDVFVIPAGHPVAINASS--DLNL 352
              Q ++   +E +++EEQE E  S Q +  RA+LS G++FV+PAGHPV   AS   DL L
Sbjct  462  SRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGL 521
Query  353  IGFGI-NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQ-SYFANAQ 410
            +GFG+ N ++N+R F+AG+ +NV  Q +R  KELAF   S  VD ++ N  Q SYF + +
Sbjct  522  LGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGR 580

Sequence Alignment: 17. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 154.4 bits 650,  Expect = 1e-38
 Identities = 161/389 41%, Positives = 251/389 64%, Gaps = 29/389 7%
Query  7    NPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDA 66
            NPF F    FQ+ +  E+G+ R+LQ+F  R  I+  +  +RL   ++ P+T+ LP++ DA
Sbjct  180  NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA 239
Query  67   DFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLAIPV 126
            + I +V +G+ TLT L   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  L  PV
Sbjct  240  EKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV 299
Query  127  NKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLKD 186
            N P Q++ F+ +G+Q   S L  FS+ ILE AFNT  E++++++  +Q     HRR    
Sbjct  300  NNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQ----SHRRQ--- 352
Query  187  RRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKFFEI 246
                   + +  K S+EQI  LS+ A S  +K  S E   FNL  R P YSN+ G+F+E 
Sbjct  353  -----QGQGMFRKASQEQIRALSQEATSPREK--SGERFAFNLLYRTPRYSNQNGRFYEA 405
Query  247  TPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVG-----QRNE 301
             P + +QL D+++ V+++ + +GS+++P+YNS+A  +V V EG G  E+V      Q + 
Sbjct  406  CPREFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSF 465
Query  302  NQGKENDKEEEQEEET-SKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFG-- 356
             + +E  +E+EQEEE  S Q +  R++LS GD+FV+PA  PV   AS + NL   GFG  
Sbjct  466  EEEEEQQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLY 525
Query  357  ---INAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQ-SYFANAQ 410
               IN ++N+R F+AG+ ++V  Q +   KELAF  SS  VD ++ N  Q SYF + Q
Sbjct  526  NQNINPDHNQRIFVAGKINHV-RQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQ 582

Sequence Alignment: 18. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 116.2 bits 482,  Expect = 3e-27
 Identities = 156/380 41%, Positives = 248/380 65%, Gaps = 38/380 10%
Query  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
            +  +ENP++F+   F++  + E G +++L+ F KRS+++  ++N+RL   ++ PHT+  P
Sbjct  55   KEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
Query  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
             + DA+++L V  G+AT+T+++   R SFN+E GD I++PAGT  Y+ NRD+NE L ++ 
Sbjct  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
Query  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
            +  PV+ PG++++F  +G ++  S+   FS  +LEAA+    E++EKV+ EQ +      
Sbjct  175  ILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSK------ 228
Query  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKK-SVSSES-GPFNLRSRNPIYSNK 239
                           IVK SRE+I  LS++ +   +      ES GP NL  ++P  SN+
Sbjct  229  -------------GSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQ 275
Query  240  FGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR 299
            FG+++E  P+ ++QLQDLD+ V+  +I +GS+  P YNSRA  I  V EG+G FE+    
Sbjct  276  FGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMAC-- 333
Query  300  NENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGI 357
                         +   +S   Q   A+L  G VFV PAGHPVA+ AS + NL  + F +
Sbjct  334  ------------PHLSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEV 381
Query  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
            NA  N R  LAG+  N++++ ER  KELAF   S EV+R++KNQ Q++F      Q+E
Sbjct  382  NAHGNSRFPLAGK-GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQE 438

Sequence Alignment: 19. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 115.4 bits 479,  Expect = 7e-27
 Identities = 160/380 42%, Positives = 244/380 64%, Gaps = 29/380 7%
Query  6    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTD 65
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+ + LP + D
Sbjct  208  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 267
Query  66   ADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
            AD IL+V+ G+  L ++  ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  268  ADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 327
Query  126  VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK 185
            ++ PGQ + F+ +G QN    LS FSK ILEAA+NT  E +  VL +Q+E          
Sbjct  328  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVLGQQRE---------- 377
Query  186  DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVS----SESGPFNLRSRNPIYSNKFG 241
                      VI++ S+EQI EL+++   S +  +     S  GP+NL ++ P+YSNK+G
Sbjct  378  ---------GVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 428
Query  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR-- 299
            + +E+ PE  +QLQD+D+ V   +I +GS++ P +N+R+  +V V  G+ D E+      
Sbjct  429  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 488
Query  300  NENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLI--GFGI 357
              + G+   K  E+EEE   + +  RA+LS  +  V+ AGHPV   +S + NL+   FGI
Sbjct  489  GRHGGRGGGKRHEEEEEV--HYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGI 546
Query  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYF 406
            NA+NN  NFLAG E NV+ Q+E    ELAF  S  EV+ L+ +Q +S F
Sbjct  547  NAQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIF 595

Sequence Alignment: 20. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 114.8 bits 476,  Expect = 1e-26
 Identities = 157/380 41%, Positives = 241/380 63%, Gaps = 29/380 7%
Query  6    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTD 65
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+ + LP + D
Sbjct  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
Query  66   ADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
            AD IL+V  G+  L ++  ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
Query  126  VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK 185
            ++ PGQ + F+ +G QN    LS FSK ILEAA+NT  E +  VL +Q+E          
Sbjct  369  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQRE---------- 418
Query  186  DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVS----SESGPFNLRSRNPIYSNKFG 241
                      VI+  S+EQI EL+++   S +  +     S  GP+NL ++ P+YSNK+G
Sbjct  419  ---------GVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 469
Query  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR-- 299
            + +E+ PE  +QLQD+D+ V   +I +GS++ P +N+R+  +V V  G+ D E+      
Sbjct  470  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 529
Query  300  NENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLI--GFGI 357
              + G+   K  E+EE+   + +  +A+LS  +  V+P GHPV   +S + NL+   FGI
Sbjct  530  GRHGGRRGGKRHEEEEDV--HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGI 587
Query  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYF 406
            NA+NN  NFLAG E NV+ Q+E    ELAF     EV+ L+ +Q +S F
Sbjct  588  NAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIF 636

Sequence Alignment: 21. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 110.9 bits 459,  Expect = 1e-25
 Identities = 152/380 40%, Positives = 257/380 67%, Gaps = 34/380 8%
Query  4    DQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            ++ENP++F+   F+T    + G I++L+KF KRSK++  ++N+R+   ++ P+T+  P +
Sbjct  96   EEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQTFISPAH 155
Query  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DA++++ V  G+AT+T ++   R +FN+E+GD +++PAGT  YL NRD+NE L ++ + 
Sbjct  156  FDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENEKLYIVKIL 215
Query  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
             PV+ PG++++F  SG ++  S+   FS  +LEAA+ T  +++EK L+ +Q Q       
Sbjct  216  RPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEK-LFGKQTQ------- 267
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSK--KSVSSESGPFNLRSRNPIYSNKFG 241
                        VI+K S+EQI  +SK+ +++ +        + PFNL  + P  SN+FG
Sbjct  268  -----------GVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQFG 316
Query  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELV----- 296
            ++FE  P++ +QLQDLD+ V+  +I +GS+  P YNSRA  I  V EG+G FE+      
Sbjct  317  RLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLS 376
Query  297  --GQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL-- 352
              G R + +G  + +   +   + +Q+   R +L PG VFV PAGHPVA+ AS + NL  
Sbjct  377  SSGSRGQREGSGSSRRRSRSGPSYQQI---RGRLRPGMVFVAPAGHPVAVIASRNKNLQV 433
Query  353  IGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYF 406
            + F +NA+ N R  LAG+ +N++++ E+  KELAF   + EV+++++NQ Q +F
Sbjct  434  LCFDVNAQGNIRFPLAGK-NNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFF 486

Sequence Alignment: 22. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 111.5 bits 462,  Expect = 1e-25
 Identities = 169/387 43%, Positives = 279/387 72%, Gaps = 34/387 8%
Query  5    QENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
            + NP+ F S  +++ +E+  G ++ L++F +R++++  ++NYR++  ++ P+T+ LP + 
Sbjct  375  RHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHK 434
Query  65   DADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ ++VV  G+ATLT +    R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  435  DAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQ 494
Query  125  PVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSL 184
            PVN PGQ++ +  +G Q+  S L  FS +IL AA+NT  + +E+ +++QQEQ        
Sbjct  495  PVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLER-FFDQQEQR------- 546
Query  185  KDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSES--GPFNLRSRNPIYSNKFGK 242
                     E VI++ S+E++  LS++A S+ ++     S  GP +L+S+   YSN+FG+
Sbjct  547  ---------EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQ 597
Query  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELV------ 296
            FFE  PE+++QLQ++D++VN  +IK G++++P+YNS+A V+V V EG G FE+       
Sbjct  598  FFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVS 657
Query  297  GQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IG 354
             Q  E +G+   +E+E+EE ++ Q Q   A+L+ GD+FVIPAGHP+AI AS + NL  +G
Sbjct  658  SQSYEYKGR---REQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVG 714
Query  355  FGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQR 414
            FGIN +NN+RNFLAG+ +N+I+Q+ER  KEL+F     E++ +++ Q +SYF    P++R
Sbjct  715  FGINGKNNQRNFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFERQVESYFV---PMER 770
Query  415  E 415
            +
Sbjct  771  Q 771

Sequence Alignment: 23. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 109.8 bits 454,  Expect = 3e-25
 Identities = 167/390 42%, Positives = 279/390 71%, Gaps = 27/390 6%
Query  5    QENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
            + NP+ F S   ++ +E+E G ++ L++F +R++++  ++NYR++   + P+T+ LP++ 
Sbjct  66   RHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPHHK 125
Query  65   DADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ ++VV  G+ATLT++    R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  126  DAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQ 185
Query  125  PVNKPGQLQSFLLSGTQN-QPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
            PVN PGQ++ +  +G ++   S L  FS +IL AA+NT  + +E+ +++QQEQ       
Sbjct  186  PVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQR------ 238
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSES--GPFNLRSRNPIYSNKFG 241
                      E VI++ S+E++  LS++A S+ ++     S  GP +L+S  P YSN+FG
Sbjct  239  ----------EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFG 288
Query  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
            +FFE  PE+++QLQ++D++VN  +IK G++++P+YNS+A V+V V EG G +E+      
Sbjct  289  QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVS 348
Query  302  NQGKEND-KEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGIN 358
            +Q  E+  + E++EEE++ + Q   A+L+ GD+FVIPAGHP+AI AS + NL  +GFGIN
Sbjct  349  SQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGIN 408
Query  359  AENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
             ENN+RNFLAG+ +++I+Q+ER  KEL+F     E++ ++++Q +SYF    P +R+
Sbjct  409  GENNQRNFLAGQ-NSIINQLEREAKELSFNMPREEIEEIFESQMESYFV---PTERQ 461

Sequence Alignment: 24. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 108.4 bits 448,  Expect = 9e-25
 Identities = 166/390 42%, Positives = 276/390 70%, Gaps = 27/390 6%
Query  5    QENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
            + NP+ F S   ++ +E+E G ++ L++F +R++++  ++NYR++   + P+T  LP++ 
Sbjct  178  RHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHK 237
Query  65   DADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ + VV  G+ATLT++    R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  238  DAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQ 297
Query  125  PVNKPGQLQSFLLSGTQN-QPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
            PVN PGQ++ +  +G ++   S L  FS +IL AA+NT  + +E+ +++QQEQ       
Sbjct  298  PVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQR------ 350
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSES--GPFNLRSRNPIYSNKFG 241
                      E VI++ S+E++  LS++A S+ ++     S  GP +L+S +P YSN+FG
Sbjct  351  ----------EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG 400
Query  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
            +FFE  PE+++QLQ++D++VN  +IK G++++P+YNS+A V+V V EG G +E+      
Sbjct  401  QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVS 460
Query  302  NQGKEND-KEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGIN 358
            +Q  E   + E++EEE++ + Q   A+L+ GD+FVIPAGHP+AI AS + NL  +GF IN
Sbjct  461  SQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDIN 520
Query  359  AENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
             ENN+R+FLAG+ +N+I+Q+ER  KEL+F     E++ ++++Q +SYF    P +R+
Sbjct  521  GENNQRDFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFESQMESYFV---PTERQ 573

Sequence Alignment: 25. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 108.2 bits 447,  Expect = 1e-24
 Identities = 139/382 36%, Positives = 247/382 64%, Gaps = 29/382 7%
Query  8    PFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDAD 67
            P++F+   F T +  ++G +R+LQKF  RS+++  ++NYR+   +++P+T+ +P + DA+
Sbjct  195  PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAE 254
Query  68   FILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLAIPVN 127
             ++ V  G+ T+++++ + R S+N+++GD +K+ AGT AYL NRD+NE L +  L  PV+
Sbjct  255  SVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVS 314
Query  128  KPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLKDR 187
             PG+++ F+ +G +N  S++  FS  ILEAAFNT  + +++++ +Q              
Sbjct  315  TPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQQ-------------- 360
Query  188  RQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKFFEIT 247
            RQ      VIVK S EQ+  +S++ +           G  N+  + P +SN++G++ E+ 
Sbjct  361  RQ-----GVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVD 415
Query  248  PEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELV-GQRNENQGKE 306
              + +QL+DLD+ V+  +I +G++  P+YNS+A  I  V +G+G FE+   + + ++G  
Sbjct  416  ASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSY 475
Query  307  NDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAENNER 364
                 + E       Q   ++L+ G V +IPAGHP    ASS+ NL  + F +NA NNE+
Sbjct  476  -----QGETRGRPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEK 530
Query  365  NFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
              LAG   NV++Q+ER  KELAF   + EV+ + ++Q++ +F    P Q++
Sbjct  531  FPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQ 579

Sequence Alignment: 26. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 105.2 bits 434,  Expect = 7e-24
 Identities = 143/377 37%, Positives = 227/377 60%, Gaps = 29/377 7%
Query  4    DQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            + ENP++F+   F T  + E G + +L KF KRSK++  L+ YRL    + P+ + +P +
Sbjct  124  EDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNH 183
Query  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+ T+T ++ N R S N+++GD I++ AGT  Y+ N D+NE L ++ L 
Sbjct  184  MDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLL 243
Query  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
             PVN PG+ + F   G +N  S+   FS+ +LEAA+ T  +++EK L+E+Q+        
Sbjct  244  QPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LFEKQD-------- 294
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSES-GPFNLRSRNPIYSNKFGK 242
                      E  IVK S+EQI  +S+  +  S    + +S G FNL  ++P  SN +G+
Sbjct  295  ----------EGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQ 344
Query  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNEN 302
            +FE   +    LQ+LDI V+ V+I +G +  P YNSRA  I  V  G+G +E+       
Sbjct  345  LFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPH--- 401
Query  303  QGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAE 360
                +  +   +E++    +   + +    VFV+PAGHP    AS + NL  + F +NAE
Sbjct  402  ---LSSSKNSGQEKSGPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAE 458
Query  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYF 406
             N R  LAG++ N+I  +E+  KELAF     EVD+++  Q + +F
Sbjct  459  GNIRYTLAGKK-NIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFF 503

Sequence Alignment: 27. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 100.7 bits 414,  Expect = 2e-22
 Identities = 139/381 36%, Positives = 226/381 59%, Gaps = 34/381 8%
Query  4    DQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            + ENP++F+   F T  + E G + LL KF ++SK++  L+ YRL    + P+ + +P +
Sbjct  146  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 205
Query  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+ T+T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  206  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 265
Query  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
             PVN PG+++ F   G +N  S+   FS  ILEAA+ T+ + +EK L+E+Q+Q       
Sbjct  266  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQ------- 317
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSES-GPFNLRSRNPIYSNKFGK 242
                         I+K S+EQ+  +S+  +       + ES G F L  ++P  SNK+G+
Sbjct  318  -----------GTIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 366
Query  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNEN 302
            +FE        L+ LD+ V+  +I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  367  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 426
Query  303  QGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAE 360
                     +    + K++   RA++    VF++PAGHP A  AS + NL  + F +NAE
Sbjct  427  S--------KSSHPSYKKL---RARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE 475
Query  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
             N R  LAG++ N+I  +E+  KELAF     EVD+++  Q + +F      ++E
Sbjct  476  GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKE 529

Sequence Alignment: 28. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 100.7 bits 414,  Expect = 2e-22
 Identities = 140/381 36%, Positives = 226/381 59%, Gaps = 34/381 8%
Query  4    DQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
            + ENP++F+   F T  + E G + LL KF ++SK++  L+ YRL    + P+ + +P +
Sbjct  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
Query  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+ T+T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
Query  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
             PVN PG+++ F   G +N  S+   FS  ILEAA+ T+ + +EK L+E+Q+Q       
Sbjct  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQ------- 319
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSES-GPFNLRSRNPIYSNKFGK 242
                         I+K S+EQI  +S+  +       + ES G F L  ++P  SNK+G+
Sbjct  320  -----------GTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 368
Query  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNEN 302
            +FE        L+ LD+ V+  +I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  369  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 428
Query  303  QGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAE 360
                     +    + K++   RA++    VF++PAGHP A  AS + NL  + F +NAE
Sbjct  429  S--------KSSHPSYKKL---RARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE 477
Query  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415
             N R  LAG++ N+I  +E+  KELAF     EVD+++  Q + +F      ++E
Sbjct  478  GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKE 531

Sequence Alignment: 29. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 94.3 bits 386,  Expect = 1e-20
 Identities = 135/386 34%, Positives = 227/386 58%, Gaps = 31/386 8%
Query  5    QENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
            +ENP++F S+RF+    +E G IR L  F + S+++E +  YR+   + KP+T+ LP+Y 
Sbjct  63   EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYI 122
Query  65   DADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA- 123
            DA +IL V  G+  +  ++ N+     LE GD   +P+G   YL N DD+  LR+  L  
Sbjct  123  DAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR 182
Query  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
                  G+ + F ++G +N  ++ S FS ++LEAAFNT+ +++E ++         HRR 
Sbjct  183  TESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG 235
Query  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESG-PFNLRSRNPIYSNKFGK 242
                        VI   + EQI E+ +    S++ + +SE   PFNLR++ P + N  G+
Sbjct  236  ------------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGR 283
Query  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR-NE 301
            F    P+ N  L  +D+ V    +  G++  P++N++A  I  V EG+G  E+      +
Sbjct  284  FTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQ 343
Query  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSD--LNLIGFGINA 359
             +G  + +E  +++   ++V   RA+L  G V+V+PAGHP+   AS++  L ++ F IN 
Sbjct  344  EHGWSSPRERGHQDINYERV---RARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT 400
Query  360  ENNERNFLAGEEDNVISQVERPVKELAF--PGSSHEVDRLLKNQKQSYFANAQPLQR 414
              NER FLAG+ +NV+  +E+ V+ L+F  P    E++ +L+ QK          QR
Sbjct  401  SGNEREFLAGK-NNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQRQR 455

Sequence Alignment: 30. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 67.6 bits 269,  Expect = 1e-12
 Identities = 106/374 28%, Positives = 196/374 52%, Gaps = 60/374 16%
Query  4    DQENP-FIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQ 62
            D+++P  +F  +    +++ + G +R+L+    R  IF   ++  +     +P +LF+PQ
Sbjct  29   DKKSPKSLFLMSNSTRVFKTDAGEMRVLKSHGGR--IF--YRHMHIGFISMEPKSLFVPQ 84
Query  63   YTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDL 122
            Y D+++I+ +  G+A L  +  ++     L+ GD   +P+G+  YL N  + + L V+  
Sbjct  85   YLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICS 144
Query  123  AIPVNKPG--QLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVL---------- 170
              P    G   +QSF + G  N  S+LSGF   ILE AFN +   +E+++          
Sbjct  145  IDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMF 204
Query  171  ---------------LEQQEQEPQHRRSLKDRRQEINEENVIVKVSREQIEEL--SKNAK 213
                           L++ ++E Q ++ ++D+ ++  EE    +  R+ +E +    N K
Sbjct  205  VDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEED-EEEKQTSRSWRKLLETVFGKVNEK 263
Query  214  SSSKKSVSSESGPFNLRS-RNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLL 272
              +K +  S +  +NL   +   + N +G    +   +   L + DI V  V +  GS+L
Sbjct  264  IENKDTAGSPAS-YNLYDDKKADFKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSML 322
Query  273  LPNYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGD 332
             P+ N  +     V  G G++  +G  N ++                     + K+  GD
Sbjct  323  APHVNPISDEYTIVLSGYGELH-IGYPNGSRA-------------------MKTKIKQGD 362
Query  333  VFVIPAGHPVAINASSD--LNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGS 390
            VFV+P   P    AS D  L + GF  +A  N+  FLAG   +++  +  P    AF  S
Sbjct  363  VFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAA-SLLRTLMGPELSAAFGVS 421
Query  391  SHEVDRLLKNQKQS 404
               + R +  Q ++
Sbjct  422  EDTLRRAVDAQHEA 435

Sequence Alignment: 31. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 59.9 bits 235,  Expect = 3e-10
 Identities = 109/384 28%, Positives = 186/384 48%, Gaps = 59/384 15%
Query  6    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTD 65
            E+  +F   R + + + + G +RL+  +  R     N     +     +P+TL++PQY D
Sbjct  51   EDRGLFILRRSKEVLKTDAGEVRLMMGYRYRG----NHSPMHIGFITMEPNTLYIPQYID 106
Query  66   ADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL---DL 122
            A +IL V  G+A +  +  N      L+ G    +PAG+  Y+ N D +E L ++   D 
Sbjct  107  ASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDT 166
Query  123  AIPVNKPGQL-QSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVL----------- 170
               +   G   QSF + G     S+LSGF  + L AAFN + +++E +L           
Sbjct  167  LESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRL 226
Query  171  --------------LEQQEQEPQHRRSLKDRRQEINEENVIVKVSREQIEEL--SKNAKS 214
                          ++ +E+  Q +    D   E  +E   V   R  ++ L    + + 
Sbjct  227  NGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRV 286
Query  215  SSKKSVSSESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLP 274
              K  ++   G +NL    P Y N +G    I       L+  ++ V  V++K G++L P
Sbjct  287  QRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSP 346
Query  275  NYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVF 334
            + N  A     +  G G  ++V                             AK+S GDVF
Sbjct  347  HVNPTATEYGIILRGSGTIQVV--------------------FPNGTAAMNAKVSEGDVF 386
Query  335  VIPAGHPVAINAS--SDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSH 392
             IP   P    AS  + L + GF  +A  N   FL G+  +++  +  P    AF  S  
Sbjct  387  WIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGK-SSLLHSMRGPELAAAFGVSEE 445
Query  393  EVDRLLKNQKQSYFANAQPLQRE 415
            +++R++K Q+++      P +RE
Sbjct  446  QLERIVKAQREAVILPTSP-HRE 467

Sequence Alignment: 32. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 38.7 bits 142,  Expect = 0.0006
 Identities = 59/201 29%, Positives = 106/201 52%, Gaps = 35/201 17%
Query  139  GTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLKDRRQEINEENVIV 198
            G   + ++++GF + +L  AFN N E I ++      Q PQ +R +  R   + EE  ++
Sbjct  166  GGSRRGNMFNGFDERLLADAFNVNPELIRRL------QRPQMQRGIIVR---VEEEFRVL 216
Query  199  KVSR--EQIEELSKNAKSSSKKSVSSESGPFNLR--SRNPIYSNKFGKFFEITPEKNQQL 254
               R  EQ +E  ++  +  +++  +     N+   SR  +Y+ + G+   +       L
Sbjct  217  SPQRGQEQEQEQEQDCDNGVEETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVL 276
Query  255  QDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQE 314
            + L +     ++ + +L  P++N     IV +T G G  ++V   +EN G  ND      
Sbjct  277  RWLQLSAEKGNLYQNALTSPHWNLNCHSIVYITRGSGRMQIV---SEN-G--ND------ 324
Query  315  EETSKQVQLYRAKLSPGDVFVIPAGHPVAINASS-DLNLIGFGINAENNERNFLAG 369
                    ++  ++  G + VIP G  V   AS+  L  I F  N +N   N LAG
Sbjct  325  --------VFNGEIREGQLIVIPQGFAVVKKASNRGLEWIAFKTN-DNAMTNQLAG 371

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.