The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK
VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI
AYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY
MENNMQNHYLICNYGPAGNYLGQLPYTKK
Sequence Info Allergen Name Length Opt Bits Score E Value
Q05109 Pol a 5 209 1459 319.0 6.8e-89
AAT95009 Pol e 5.0101 226 1432 313.3 3.8e-87
P35759 Pol e 5.0101 205 1415 309.6 4.4e-86
P35780 Pol f 5 205 1346 294.9 1.2e-81
P81656 Pol d 5 206 1240 272.3 7.3e-75
P83377 Pol g 5 206 1237 271.7 1.1e-74
Q7Z156 Poly s 5.0101 207 1117 246.2 5.5e-67
C0HJV9 Poly p 5.0101 206 1116 246.0 6.4e-67
P86686 Poly p 5.0102 207 1097 241.9 1.1e-65
Q05108 Dol a 5 203 959 212.5 7.3e-57
P10737 Dol m 5.02 215 929 206.2 6.3e-55
AAA28302 Dol m 5.02 212 921 204.5 2e-54
P35786 Ves s 5 205 887 197.2 3e-52
P35781 Vesp c 5 202 886 197.0 3.5e-52
P35785 Ves p 5 204 883 196.3 5.4e-52
P10736 Dol m 5.0101 227 882 196.2 6.7e-52
P35787 Ves vi 5 206 880 195.7 8.5e-52
P0DMB9 Vesp v 5.0101 202 879 195.5 9.8e-52
P35782 Vesp c 5 202 873 194.2 2.4e-51
P81657 Vesp m 5 202 863 192.1 1e-50
P35760 Ves m 5 204 860 191.5 1.6e-50
P35784 Ves g 5 204 859 191.2 1.9e-50
Q05110 Ves v 5 227 859 191.3 2e-50
P35783 Ves f 5 204 854 190.2 3.9e-50
P35779 Sol r 3 211 643 145.3 1.3e-36
C0ITL3 Pac c 3.0101 199 625 141.4 1.8e-35
P35778 Sol i 3 234 622 140.9 3.1e-35
QEA69430 Sco m 5.0101 210 341 81.0 3e-17
AAF65314 Cte f 2 264 306 73.7 5.9e-15
7065471 Pol m 5.0101 37 244 59.3 1.8e-11
ABC58726 Sol s 3.0101 90 245 60.0 2.6e-11
AAY32926 Sol g 3.0101 70 224 55.4 5e-10
AAU15051 Cyn d 24.0101 153 225 56.1 6.7e-10
AVD29822 Art an 2.0101 163 209 52.7 7.4e-09
AVD29825 Art gm 2.0101 163 209 52.7 7.4e-09
AVD29826 Art la 2.0101 163 208 52.5 8.6e-09
A0A2L1DGQ3 Art ar 2.0101 163 208 52.5 8.6e-09
AVD29827 Art si 2.0101 163 208 52.5 8.6e-09
AVD29824 Art ca 2.0101 163 206 52.1 1.2e-08
XP_007199020 Pru p 9.0101 161 191 48.9 1e-07
ADM18345 Tab y 5.0101 256 175 45.8 1.4e-06
AAF82096 Glo m 5 259 163 43.2 8.6e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 319.0 bits 1459,  Expect = 7e-89
 Identities = 209/209 100%, Positives = 209/209 100%, Gaps = 0/209 0%
Query  1    SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK 60
            SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK
Sbjct  1    SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK 60
Query  61   VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI 120
            VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI
Sbjct  61   VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI 120
Query  121  AYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY 180
            AYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY
Sbjct  121  AYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY 180
Query  181  MENNMQNHYLICNYGPAGNYLGQLPYTKK 209
            MENNMQNHYLICNYGPAGNYLGQLPYTKK
Sbjct  181  MENNMQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 2. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 313.3 bits 1432,  Expect = 4e-87
 Identities = 205/209 98%, Positives = 206/209 98%, Gaps = 0/209 0%
Query  1    SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK 60
            SSQGVDYCKI+CPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK
Sbjct  18   SSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK 77
Query  61   VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI 120
            VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI
Sbjct  78   VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI 137
Query  121  AYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY 180
            AYAGGS LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY
Sbjct  138  AYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY 197
Query  181  MENNMQNHYLICNYGPAGNYLGQLPYTKK 209
            MEN MQNHYLICNYGPAGNYLGQLP TKK
Sbjct  198  MENKMQNHYLICNYGPAGNYLGQLPNTKK 226

Sequence Alignment: 3. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 309.6 bits 1415,  Expect = 4e-86
 Identities = 202/205 98%, Positives = 203/205 99%, Gaps = 0/205 0%
Query  5    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
            VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG
Sbjct  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
Query  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
            LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG
Sbjct  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
Query  125  GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
            GS LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY+EN 
Sbjct  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
Query  185  MQNHYLICNYGPAGNYLGQLPYTKK 209
            MQNHYLICNYGPAGNYLGQLPYTKK
Sbjct  181  MQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 4. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 294.9 bits 1346,  Expect = 1e-81
 Identities = 191/205 93%, Positives = 197/205 96%, Gaps = 0/205 0%
Query  5    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
            VDYCKIKC SGIHTVCQYGESTKPSKNCA KVIKSVGPTEEEKKLIV+EHNRFRQKVAQG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
Query  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
            LETRGNPGPQPAASDMN+LVWNDELAHIAQVWASQCQ LVHDKCRNTAKY VGQNIAYAG
Sbjct  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
Query  125  GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
            GS LPDVVSLIKLWENEVKDFNYN GITKQNF K+GHYTQM+W KTKEIGCGSLKYM+NN
Sbjct  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
Query  185  MQNHYLICNYGPAGNYLGQLPYTKK 209
            MQ+HYLICNYGPAGNYLGQLPYTKK
Sbjct  181  MQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 5. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 272.3 bits 1240,  Expect = 7e-75
 Identities = 176/204 86%, Positives = 187/204 91%, Gaps = 1/204 0%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            DYCKIKC SG+HTVCQYGESTKPSKNCAGK+IKSVGPTEEEKKLIV EHNRFRQKVA+GL
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 125
            ETRGNPGPQPAAS+MN+LVWNDELA IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
Query  126  SN-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
            SN +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E N
Sbjct  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
Query  185  MQNHYLICNYGPAGNYLGQLPYTKK 209
            MQ HYLICNYGPAGNYLGQ  YTKK
Sbjct  182  MQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 6. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 271.7 bits 1237,  Expect = 1e-74
 Identities = 176/204 86%, Positives = 186/204 91%, Gaps = 1/204 0%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            DYCKIKC SG+HTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIV EHNRFRQKVAQGL
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQGL 61
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 125
            ETRGNPGPQPAAS+MN+LVWNDE A IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
Query  126  SN-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
            SN +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E N
Sbjct  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
Query  185  MQNHYLICNYGPAGNYLGQLPYTKK 209
            M+ HYLICNYGPAGNYLGQ  YTKK
Sbjct  182  MKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 7. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 246.2 bits 1117,  Expect = 6e-67
 Identities = 160/203 78%, Positives = 178/203 87%, Gaps = 2/203 0%
Query  7    YCKIKCPSGIHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            YC IKC    HTVCQYGESTKPS KNC    I SVG TEEEKKLIV EHNRFRQKVAQGL
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 62
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AG 124
            ETRGNPGPQPAASDMN+LVWNDELA+IAQVWA+QCQF+VHDKCRNTA+Y VGQNIAY A 
Sbjct  63   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSAS 122
Query  125  GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
             +  P +VSLI LWENEVKDFNY+ GITK+NFAK+GHYTQ+VW KTKE+GCGS+KY+E  
Sbjct  123  TAAYPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKG 182
Query  185  MQNHYLICNYGPAGNYLGQLPYTKK 209
            M++HYL+CNYGPAGNY+GQ  YTKK
Sbjct  183  MKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 8. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 246.0 bits 1116,  Expect = 6e-67
 Identities = 158/203 77%, Positives = 176/203 86%, Gaps = 1/203 0%
Query  7    YCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLE 66
            YC IKC    HTVCQYGESTKPS  C    I SVG TEEEKKLIV EHNRFRQKVAQGLE
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLE 62
Query  67   TRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AGG 125
            TRGNPGPQPAASDMN+LVWNDELA+IAQVWASQCQF+VHDKCRNTA+Y VGQNIAY A  
Sbjct  63   TRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAST 122
Query  126  SNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENNM 185
            +  P +VSLI LWENEVKDFNY+ GITK+NF+K+GHYTQ+VW KTKE+GCGS+KY+E  M
Sbjct  123  AAYPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYIEKGM 182
Query  186  QNHYLICNYGPAGNYLGQLPYTKK 209
            ++HYL+CNYGPAGNY+GQ  YTKK
Sbjct  183  KSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 9. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 241.9 bits 1097,  Expect = 1e-65
 Identities = 160/203 78%, Positives = 174/203 85%, Gaps = 2/203 0%
Query  7    YCKIKCPSGIHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            YC IKC    HTVCQ GESTKPS KNCA   I SVG TEEEKKLIV EHNRFRQKVAQGL
Sbjct  3    YCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 62
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AG 124
            ETRGNPGPQPAASDMN+LVWNDELA+IAQVWASQCQF+VHDKCRNTA+Y VGQNIAY A 
Sbjct  63   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAS 122
Query  125  GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
             +  P VV LI LWENEVKDFNYNTGITK+NFAK+GHYTQ+VW KTKE+GCGS+KY+E  
Sbjct  123  TAAYPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKG 182
Query  185  MQNHYLICNYGPAGNYLGQLPYTKK 209
            M++HYL+CNYGPAGN LG   Y  K
Sbjct  183  MKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 10. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 212.5 bits 959,  Expect = 7e-57
 Identities = 134/200 67%, Positives = 160/200 80%, Gaps = 6/200 3%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            +YCKI CP G HT+C+YG S KP  NC GK++KS G T +EK  IV  HN FRQKVAQGL
Sbjct  2    NYCKI-CPKGTHTLCKYGTSMKP--NCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGL 58
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 124
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNTAKYPVGQN+A A  
Sbjct  59   ETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFG-HDQCRNTAKYPVGQNVAIAST 117
Query  125  -GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 183
             G++   +  LIK+WE+EVKD+N +  +   NF+K+GHYTQMVWGKTKEIGCGS+KY+EN
Sbjct  118  TGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIEN 177
Query  184  NMQNHYLICNYGPAGNYLGQLPYTKK 209
              + HYL+CNYGPAGNY+ Q  Y +K
Sbjct  178  KWHTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 11. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 206.2 bits 929,  Expect = 6e-55
 Identities = 131/201 65%, Positives = 160/201 79%, Gaps = 6/201 2%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            +YCKIKC  GIHT+C++G S KP  NC  K++K  G + +EK  IV+ HN+FRQKVA+GL
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 124
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNT KY VGQN+A A  
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFG-HDQCRNTEKYQVGQNVAIAST 128
Query  125  -GSNLPDVVSLIKLWENEVKDFNYNTG-ITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 182
             G++   +  LI++WENEVKDFN   G +   NF+K+GHYTQMVWGKTKEIGCGS+KY+E
Sbjct  129  TGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 188
Query  183  NNMQNHYLICNYGPAGNYLGQLPYTKK 209
            NN + HYL+CNYGPAGNY+ Q  Y +K
Sbjct  189  NNWHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 12. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 204.5 bits 921,  Expect = 2e-54
 Identities = 130/198 65%, Positives = 158/198 79%, Gaps = 6/198 3%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            +YCKIKC  GIHT+C++G S KP  NC  K++K  G + +EK  IV+ HN+FRQKVA+GL
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 124
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNT KY VGQN+A A  
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFG-HDQCRNTEKYQVGQNVAIAST 128
Query  125  -GSNLPDVVSLIKLWENEVKDFNYNTG-ITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 182
             G++   +  LI++WENEVKDFN   G +   NF+K+GHYTQMVWGKTKEIGCGS+KY+E
Sbjct  129  TGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 188
Query  183  NNMQNHYLICNYGPAGNYLGQLPY 206
            NN + HYL+CNYGPAGNY+ Q  Y
Sbjct  189  NNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 13. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 197.2 bits 887,  Expect = 3e-52
 Identities = 127/202 62%, Positives = 155/202 76%, Gaps = 6/202 2%
Query  5    VDYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 63
            VDYCKIKC   G+HT C+YG STKP  NC   V+KS G T+ EK+ I+  HN FR KVA+
Sbjct  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
Query  64   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYA 123
            GLETRGNPGPQP A +MN+LVWN+ELA+IAQ+WASQC++  HD C++T KY VGQNIA +
Sbjct  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVS 117
Query  124  GGSN--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 181
              +     +V +L+K WENEVKDFN      +  F KIGHYTQMVW KTKEIGCGS+KY+
Sbjct  118  SSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYV 177
Query  182  ENNMQNHYLICNYGPAGNYLGQLPYTKK 209
            +NN   HYL+CNYGPAGN+  Q  Y +K
Sbjct  178  DNNWYTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 14. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 197.0 bits 886,  Expect = 3e-52
 Identities = 128/198 64%, Positives = 158/198 79%, Gaps = 9/198 4%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T++E   I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 125
            ETRGNPGPQP A  MN LVWNDELA+IAQVWA+QC +  HD CRN+AKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAEGST 118
Query  126  S--NLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 183
            +  N+  V +++K+WE+EVKD+ Y  G  K  + K+GHYTQMVW KTKEIGCGS+KY+EN
Sbjct  119  TADNFGSVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYIEN 176
Query  184  NMQNHYLICNYGPAGNYLGQLP-YTKK 209
              + HYL+CNYGPAGN +G  P Y +K
Sbjct  177  GWHRHYLVCNYGPAGN-VGNEPIYERK 202

Sequence Alignment: 15. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 196.3 bits 883,  Expect = 5e-52
 Identities = 122/200 61%, Positives = 156/200 78%, Gaps = 7/200 3%
Query  6    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
            +YCKIKC   G+HT C+YG S KP  NC  K++ S G T+EEK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARG 58
Query  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
            LETRGNPGPQP A +M +LVWNDELA++AQVWA+QCQ+  HD CR+ AKYPVGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYPVGQNVALTG 117
Query  125  GS--NLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 182
             +     + V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKEIGCGS+KY++
Sbjct  118  STADKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYIQ 177
Query  183  NNMQNHYLICNYGPAGNYLGQLPYTKK 209
            N  + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  NEWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 16. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 196.2 bits 882,  Expect = 7e-52
 Identities = 125/201 62%, Positives = 149/201 74%, Gaps = 5/201 2%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            +YCKIKC  GIHT+C++G S KP  NC   V+K+ G T +EK  I+  HN FRQ VA+GL
Sbjct  25   NYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 124
            ETRG PGPQP A +MN LVWNDELA IAQ WA+QC F  HD CRNTAKY VGQNIA +  
Sbjct  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDF-NHDDCRNTAKYQVGQNIAISST 141
Query  125  -GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 183
              + +     LIK WE+EV +FNY  G+   NF K+GHYTQMVWGKTKEIGCGS+KY+E+
Sbjct  142  TATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIED 201
Query  184  NMQNHYLICNYGPAGNYLGQLPYTKK 209
            N   HYL+CNYGP GN + Q  Y +K
Sbjct  202  NWYTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 17. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 195.7 bits 880,  Expect = 9e-52
 Identities = 129/202 63%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  5    VDYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 63
            V+YCKIKC   G+HT C+YG STKP  NC   V+K+ G TE EK+ I+  HN FRQKVA+
Sbjct  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
Query  64   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIA-Y 122
            GLETRGNPGPQP A +MN+LVWNDELA+IAQVWASQC +  HD C++T KYPVGQNIA  
Sbjct  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKR 118
Query  123  AGGSNLPDVVS-LIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 181
            +  + L D    L+K+WENEVKDFN N   +K N+ K GHYTQMVW KTKEIGCGS+KY+
Sbjct  119  STTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
Query  182  ENNMQNHYLICNYGPAGNYLGQLPYTKK 209
            ++    HYL+CNYGP+GN+  +  Y KK
Sbjct  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 18. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 195.5 bits 879,  Expect = 1e-51
 Identities = 128/198 64%, Positives = 159/198 80%, Gaps = 9/198 4%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T+ EK  I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGRSVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 124
            ETRGNPGPQP A  MN LVWNDELA+IAQVWASQC++  HD CRNTAKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYG-HDNCRNTAKYLVGQNIAEQST 118
Query  125  -GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 183
              +++  V +++K+W +EVKD+ Y  G +K  +  +GHYTQMVW KTKEIGCG++KY+EN
Sbjct  119  TAASFEPVSNMVKMWSDEVKDYQY--GSSKNKLNDVGHYTQMVWAKTKEIGCGNIKYIEN 176
Query  184  NMQNHYLICNYGPAGNYLGQLP-YTKK 209
              ++HYL+CNYGPAGN +G  P Y KK
Sbjct  177  GWHHHYLVCNYGPAGN-IGNEPIYEKK 202

Sequence Alignment: 19. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 194.2 bits 873,  Expect = 2e-51
 Identities = 127/198 64%, Positives = 157/198 79%, Gaps = 9/198 4%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T++E   I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 125
            ETRGNPGPQP A  MN LVWNDELA+IAQVWA+QC +  HD CRN+AKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAEGST 118
Query  126  S--NLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 183
            S  N+ +V +++K+WE+EVKD+ Y  G  K  + K+GHYTQMVW KTKEIGCGS  Y+E+
Sbjct  119  SADNFVNVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIED 176
Query  184  NMQNHYLICNYGPAGNYLGQLP-YTKK 209
              + HYL+CNYGPAGN +G  P Y +K
Sbjct  177  GWHRHYLVCNYGPAGN-VGNEPIYERK 202

Sequence Alignment: 20. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 192.1 bits 863,  Expect = 1e-50
 Identities = 125/198 63%, Positives = 157/198 79%, Gaps = 9/198 4%
Query  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
            +YCKIKC SGIHT+C++G STKP  NC   V+K+ G T+ EK  I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKFGISTKP--NCGKNVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 125
            ETRG PGPQP A  MN LVWNDELA+IAQVWA QC +  HD CRNTAKY VGQNIA  G 
Sbjct  60   ETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYG-HDVCRNTAKYSVGQNIAENGS 118
Query  126  S--NLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 183
            +  ++  V +++++W +EVK++ Y  G TK  + ++GHYTQMVW KTKEIGCGS+KY+EN
Sbjct  119  TAASFASVSNMVQMWADEVKNYQY--GSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIEN 176
Query  184  NMQNHYLICNYGPAGNYLGQLP-YTKK 209
              + HYL+CNYGPAGN +G  P Y +K
Sbjct  177  GWHRHYLVCNYGPAGN-IGNEPIYERK 202

Sequence Alignment: 21. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 191.5 bits 860,  Expect = 2e-50
 Identities = 120/200 60%, Positives = 154/200 77%, Gaps = 7/200 3%
Query  6    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
            +YCKIKC   G+HT C+YG S KP  NC  K + S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARG 58
Query  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 117
Query  125  GSN--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 182
             +     D V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KY++
Sbjct  118  STAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
Query  183  NNMQNHYLICNYGPAGNYLGQLPYTKK 209
             N + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  ENWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 22. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 191.2 bits 859,  Expect = 2e-50
 Identities = 119/200 59%, Positives = 156/200 78%, Gaps = 7/200 3%
Query  6    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
            +YCKIKC   G+HT C+Y ES KP  NCA K + + G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKY-ESLKP--NCANKKVVAYGLTKQEKQDILKEHNDFRQKIARG 58
Query  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKYPVGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYPVGQNVALTG 117
Query  125  GS--NLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 182
             +     + V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KY++
Sbjct  118  STAAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
Query  183  NNMQNHYLICNYGPAGNYLGQLPYTKK 209
            +  + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  DKWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 23. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 191.3 bits 859,  Expect = 2e-50
 Identities = 118/200 59%, Positives = 153/200 76%, Gaps = 7/200 3%
Query  6    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
            +YCKIKC   G+HT C+YG S KP  NC  KV+ S G T++EK+ I+ EHN FRQK+A+G
Sbjct  25   NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARG 81
Query  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
            LETRGNPGPQP A +M +LVWNDELA++AQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  82   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 140
Query  125  GS--NLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 182
             +     D V L+K+WE+EVKD+N     +  +F K GHYTQMVW  TKE+GCGS+KY++
Sbjct  141  STAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQ 200
Query  183  NNMQNHYLICNYGPAGNYLGQLPYTKK 209
               + HYL+CNYGP+GN++ +  Y  K
Sbjct  201  EKWHKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 24. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 190.2 bits 854,  Expect = 4e-50
 Identities = 118/200 59%, Positives = 152/200 76%, Gaps = 7/200 3%
Query  6    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
            +YCKIKC   G+HT C+YG S KP  NC  KV+ S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARG 58
Query  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
            LETRGNPGPQP A +M +LVWNDELA++AQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDIAKYQVGQNVALTG 117
Query  125  GS--NLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 182
             +     D V L+K+WE+EVKD+N     +  NF K GHYTQMVW  TKE+GCGS+K+++
Sbjct  118  STAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQ 177
Query  183  NNMQNHYLICNYGPAGNYLGQLPYTKK 209
               + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  EKWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 25. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 145.3 bits 643,  Expect = 1e-36
 Identities = 103/199 51%, Positives = 132/199 66%, Gaps = 15/199 7%
Query  6    DYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVA 62
            +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  63   QGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY 122
             G E RG  GPQP A  M +L W+ ELA IAQ WA+QC F  HD CRN  ++ VGQNIA 
Sbjct  59   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIAA 117
Query  123  --AGGSNLPDVVSLIKLWENEVKDFNYNTGITK-----QNFAKIGHYTQMVWGKTKEIGC 175
              + G N   +  +I LW NEVKDF+ N  I+        +  +GHYTQ+VW KTK+IGC
Sbjct  118  TSSSGKNKSTLSDMILLWYNEVKDFD-NRWISSFPSDGNILMHVGHYTQIVWAKTKKIGC 176
Query  176  GSLKYMENNMQNHYLICNYGPAGNYLGQLPYTKK 209
            G + + E+N   HYL+CNYGPAGN LG   Y  K
Sbjct  177  GRIMFKEDNWNKHYLVCNYGPAGNVLGAQIYEIK 210

Sequence Alignment: 26. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 141.4 bits 625,  Expect = 2e-35
 Identities = 94/183 51%, Positives = 129/183 70%, Gaps = 10/183 5%
Query  16   IHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQP 75
            +HT+CQY  S +PS NC      +   T  +K+ I+  HN  RQKV  G ETRGNPGPQP
Sbjct  6    VHTMCQY-TSPQPSPNCG--TYSNAHITAADKETILKVHNDERQKVKAGQETRGNPGPQP 62
Query  76   AASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGGSNL-P-DVVS 133
            AAS+M DL W++ELA IAQ W +QC+ + HD CRN  +Y VGQNIA +G +   P ++ +
Sbjct  63   AASNMPDLTWDNELAAIAQRWVNQCK-IGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  134  LIKLWENEVKDFN---YNTGITKQN-FAKIGHYTQMVWGKTKEIGCGSLKYMENNMQNHY 189
            L+++W NEV  +N    ++  +  N F KIGHYTQ+VWGKT ++GCG +++++      Y
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  190  LICNYGPAGNYLG 202
            L CNYGPAGN +G
Sbjct  182  LACNYGPAGNMFG 194

Sequence Alignment: 27. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 140.9 bits 622,  Expect = 3e-35
 Identities = 104/204 50%, Positives = 134/204 65%, Gaps = 16/204 7%
Query  1    SSQGVDYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRF 57
            ++   +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +
Sbjct  19   NTLATNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEKDAIVNKHNEL 75
Query  58   RQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVG 117
            RQ+VA G E RG  GPQP A  M +L W+ ELA IAQ WA+QC F  HD CRN  ++ VG
Sbjct  76   RQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVG 134
Query  118  QNIAY--AGGSNLPDVVSLIKLWENEVKDFNYNTGITK----QN-FAKIGHYTQMVWGKT 170
            QNIA   + G N      +I LW NEVKDF+ N  I+      N + K+GHYTQ+VW KT
Sbjct  135  QNIAATSSSGKNKSTPNEMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKT 193
Query  171  KEIGCGSLKYME-NNMQNHYLICNYGPAGNYLGQLPYTKK 209
             +IGCG + + E +N   HYL+CNYGPAGN LG   Y  K
Sbjct  194  TKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 81.0 bits 341,  Expect = 3e-17
 Identities = 69/164 42%, Positives = 100/164 60%, Gaps = 16/164 9%
Query  34   GKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIA 93
            G  +K  G     KK+I+  HN+ RQ VA G ++    G QP+A++M +L W+D++A  A
Sbjct  23   GCDMKVRGLDANMKKMILDLHNKKRQTVANGQQS----G-QPSAANMKELHWDDQIAANA 77
Query  94   QVWASQCQFLVHDKC-RNTAKYP-VGQNIAYAGGSNLPDVVSL-IKLWENEVKDFNYNTG 150
            Q  A  C F    K  R T+KY  +G+NI Y G  + PD +   +  W +EVKD      
Sbjct  78   QRSAETCVFQHTAKNLRKTSKYSYLGENI-YMG--SYPDPIPRSVNAWYDEVKDVTPAVV 134
Query  151  IT-KQNFAKIGHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPYTKK 209
             + +     IGHYTQMVW  T+ +GCG    +  + +N Y+ C YGP+GNY G+ P  K+
Sbjct  135  KSFRSGGPMIGHYTQMVWANTEALGCG---LVTASDKNTYIFCQYGPSGNYPGE-PIYKQ 190

Sequence Alignment: 29. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 73.7 bits 306,  Expect = 6e-15
 Identities = 77/193 39%, Positives = 104/193 53%, Gaps = 27/193 13%
Query  6    DYCKIKCPSGIHTVCQYGESTKPS--KNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 63
            DYC + C +G +  C     TKP   ++C     K V  TE  KK  ++ HNR R+ VA 
Sbjct  33   DYCNLNCTNGPNVGC-----TKPDVPRDCQN--FKLVNITERMKKAFLNAHNRKRRLVAA 85
Query  64   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYA 123
            G     +    P A+ M +L WN  LA +A+    QC+ + HD C  T     GQN+ + 
Sbjct  86   GKGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCE-MKHD-CAKTRHGHTGQNLFFY 143
Query  124  GGSNLPDVVSLI-KL----WENEVKDFNYNTGITK-----QNFAKIGHYTQMVWGKTKEI 173
            G +  P   S I K+    W  E KD      I K      N   IGHYTQ++WG T ++
Sbjct  144  GTTLSPIKNSTIAKMAVDGWYAESKDTRLED-IKKLTTIYPNGKPIGHYTQLIWGNTTKV 202
Query  174  GCGSLKYMEN---NMQNHYLI-CNYGPAGNYLGQLPYTKK 209
            GC    Y ++   NM N  L+ CNY   GN L +  Y  K
Sbjct  203  GCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 30. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 59.3 bits 244,  Expect = 2e-11
 Identities = 35/37 94%, Positives = 35/37 94%, Gaps = 0/37 0%
Query  5    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVG 41
            VDYCKIKC SGIHTVCQYGESTKPSKNCA KVIKSVG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 31. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 60.0 bits 245,  Expect = 3e-11
 Identities = 42/86 48%, Positives = 55/86 63%, Gaps = 6/86 6%
Query  6    DYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVA 62
            +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  63   QGLETRGNPGPQPAASDMNDLVWNDELAHIAQ 94
             G E RG   PQP A  M +L W+ ELA IAQ
Sbjct  59   SGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 32. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 55.4 bits 224,  Expect = 5e-10
 Identities = 32/52 61%, Positives = 38/52 73%, Gaps = 1/52 1%
Query  158  KIGHYTQMVWGKTKEIGCGSLKYME-NNMQNHYLICNYGPAGNYLGQLPYTKK 209
            KIGHYTQ+VW KT +IGCG + + E +N   HYL+CNYGPAGN LG   Y  K
Sbjct  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69

Sequence Alignment: 33. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 56.1 bits 225,  Expect = 7e-10
 Identities = 47/141 33%, Positives = 77/141 54%, Gaps = 26/141 18%
Query  41   GPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC 100
            G  ++  + I++EHN FR K                   +  L WN  LA  +Q +A   
Sbjct  12   GLNDKAIQDILNEHNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK 54
Query  101  QFLVHDKCRNT-AKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKI 159
              L  D C+   +  P G+N+ +  GS      + +  W +E K ++Y +    Q     
Sbjct  55   --LKKD-CKMVHSDSPYGENLMF--GSGAISWKTTVDTWSDEKKSYHYGSNTCDQG-KMC 108
Query  160  GHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206
            GHYT +VW  T  +GCG  + + ++ ++  ++C+Y P GNY  Q PY
Sbjct  109  GHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQKPY 153

Sequence Alignment: 34. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 52.7 bits 209,  Expect = 7e-09
 Identities = 55/124 44%, Positives = 77/124 62%, Gaps = 32/124 25%
Query  66   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKCRN 110
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRC-- 82
Query  111  TAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKT 170
                  G+N+A  G  N    V   +LW +E  D++YN     +     GHYTQ+VW  T
Sbjct  83   ------GENMAQ-GAINGSMAV---QLWLDERLDYDYNE---NKCIKMCGHYTQIVWANT 129
Query  171  KEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206
            + +GCG  + + +N   +  +CNY P GN +GQ PY
Sbjct  130  ERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 35. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 52.7 bits 209,  Expect = 7e-09
 Identities = 55/124 44%, Positives = 77/124 62%, Gaps = 32/124 25%
Query  66   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKCRN 110
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRC-- 82
Query  111  TAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKT 170
                  G+N+A  G  N    V   +LW +E  D++YN     +     GHYTQ+VW  T
Sbjct  83   ------GENMAQ-GAINGSMAV---QLWLDERLDYDYNE---NKCIKMCGHYTQIVWANT 129
Query  171  KEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206
            + +GCG  + + +N   +  +CNY P GN +GQ PY
Sbjct  130  ERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 52.5 bits 208,  Expect = 9e-09
 Identities = 54/124 43%, Positives = 78/124 62%, Gaps = 32/124 25%
Query  66   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKCRN 110
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
Query  111  TAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKT 170
                  G+N+A  G  N    V   +LW +E  D++YN     +     GHYTQ+VW  +
Sbjct  83   ------GENMAQ-GAINGSMAV---QLWLDERLDYDYNE---NKCIKMCGHYTQIVWANS 129
Query  171  KEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206
            + +GCG  + + +N   + ++CNY P GN +GQ PY
Sbjct  130  ERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 52.5 bits 208,  Expect = 9e-09
 Identities = 54/124 43%, Positives = 78/124 62%, Gaps = 32/124 25%
Query  66   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKCRN 110
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
Query  111  TAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKT 170
                  G+N+A  G  N    V   +LW +E  D++YN     +     GHYTQ+VW  +
Sbjct  83   ------GENMAQ-GAINGSMAV---QLWLDERLDYDYNE---NKCIKMCGHYTQIVWANS 129
Query  171  KEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206
            + +GCG  + + +N   + ++CNY P GN +GQ PY
Sbjct  130  ERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 52.5 bits 208,  Expect = 9e-09
 Identities = 54/124 43%, Positives = 79/124 63%, Gaps = 32/124 25%
Query  66   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWA----SQCQFLVHDKCRN 110
            ET G PG  P     A +       M  L W+DELA +AQ WA    + C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTADCSLVHSDRC-- 82
Query  111  TAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKT 170
                  G+N+A  G  N    V   +LW +E  D++YN     +     GHYTQ+VW  +
Sbjct  83   ------GENMAQ-GAINGSMAV---QLWLDERLDYDYNE---NKCIKMCGHYTQIVWANS 129
Query  171  KEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206
            + +GCG  + + +N   + ++CNY P GN +GQ PY
Sbjct  130  ERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 39. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 52.1 bits 206,  Expect = 1e-08
 Identities = 47/110 42%, Positives = 70/110 63%, Gaps = 21/110 19%
Query  80   MNDLVWNDELAHIAQVWAS----QCQFLVHDKCRNTAKYPVGQNIAYAGGSNLPDVVSLI 135
            M  L W+DELA +AQ WA      C ++  D+C        G+N+A  G  N    V   
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC--------GENMAQ-GAINGSMAV--- 97
Query  136  KLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYG 195
            +LW +E  D++YN     +     GHYTQ+VW  ++ +GCG  + + +N   + ++CNY 
Sbjct  98   QLWLDERLDYDYNEN---KCIKMCGHYTQIVWANSERVGCG--RALCSNGWAYIIVCNYD 152
Query  196  PAGNYLGQLPY 206
            P GN +GQ PY
Sbjct  153  PPGNVVGQKPY 163

Sequence Alignment: 40. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 48.9 bits 191,  Expect = 1e-07
 Identities = 55/140 39%, Positives = 78/140 55%, Gaps = 28/140 20%
Query  39   SVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWAS 98
            S   ++EE    V EHN+ R++V          G +P       L WN  LA+ AQ +A 
Sbjct  22   SANISKEEIDGFVEEHNKARKEV----------GNKP-------LKWNTTLAQYAQEYAD 64
Query  99   QCQFLVHDKCRNTAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAK 158
            +    V D     +    G+N+  A G  +    +  K W  E K+F Y+    K    +
Sbjct  65   K---RVGDCAMEHSMGRWGENL--ASGDGMSGAAAT-KYWVTE-KEF-YDEKSNKCVKDE 116
Query  159  IGHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206
             GHY  +VWGKT E+GCG  K   NN QN Y++C+Y P      + PY
Sbjct  117  CGHYLAVVWGKTTEVGCGISKC--NNGQN-YVVCSYDPMYQPEDERPY 161

Sequence Alignment: 41. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 45.8 bits 175,  Expect = 1e-06
 Identities = 54/184 29%, Positives = 91/184 49%, Gaps = 22/184 11%
Query  5    VDYCKI-KCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 63
            +DYC + +   G H  C  G S   S +C G+  ++   T+E KK+I+ + N  R  VA+
Sbjct  24   LDYCSLCRGGRGEHVGC--G-SPGFSSDC-GQKARTRKFTKEHKKVILDKINDVRDHVAK 79
Query  64   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKY--PVGQNIA 121
            G  + G     P AS M  +VW++ELA +A+     C    + KCR+T ++  P   N  
Sbjct  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFE 132
Query  122  YAGGSNLPDVVSLIK--LWENEVKDFNYNTGITK--QNFAKIGHYTQM---VWGKTKEIG 174
            +     +P  +SLI   +     +  N    I +  Q     G+  ++   +  +   +G
Sbjct  133  FYA-DKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVG 191
Query  175  CGSLKYMENNMQNHYLICNYGPAGNY 200
            CG   +         L CN+    +Y
Sbjct  192  CGLTTWKLGGKARALLTCNFSSENDY 217

Sequence Alignment: 42. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 43.2 bits 163,  Expect = 9e-06
 Identities = 67/190 35%, Positives = 101/190 53%, Gaps = 26/190 13%
Query  4    GVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 63
            G DYC + C +  H  C      +       K+I       + +  ++  HN+ R  VA 
Sbjct  19   GGDYCGL-CDN--HDACVMQNVFQSGCPSGAKMI----DLNKYQSALLDAHNKKRNHVAG 71
Query  64   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYP-VGQNIAY 122
            G E++        A  M  + W+ ELA +A+    QCQ + HD+CRNT K+   GQN+A 
Sbjct  72   GGESK-----LKRACQMATMKWDSELAKLAEYNVKQCQ-MNHDRCRNTVKFKYAGQNLAE 125
Query  123  AG--GSNLPDVVSLIKL----WENEVKDFNYN-TGITKQNF--AKIGHYTQMVWGKTKEI 173
             G  G   PD   LI+     W  EVKD N         N+    IGH+T MV  +   +
Sbjct  126  LGRSGGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHV 185
Query  174  GCGSLKYMENNMQNHYLI-CNYGPAGNYLGQLPYTK 208
            GC + +Y ++N   ++L+ CNY  A   + ++P  K
Sbjct  186  GCAASEYTKSNGFQYFLMACNY--ATTNMMEFPIYK 219

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.