The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC
RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI
Sequence Info Allergen Name Length Opt Bits Score E Value
CAZ76052 Tri a 29.0101 120 874 107.7 8.8e-26
CAA35598 Tri a TAI 145 863 106.7 2.1e-25
CAA39099 Tri a TAI 145 823 102.3 4.6e-24
CBA13559 Tri a 29.0201 120 802 99.8 2.2e-23
CAA49555 Hor v 1 145 762 95.6 4.8e-22
CAA41956 Hor v 1 144 733 92.4 4.4e-21
CAA49556 Hor v 1 149 440 60.1 2.3e-11
CAA34709 Tri a TAI 143 422 58.1 9e-11
CAA42453 Tri a TAI 143 409 56.7 2.4e-10
Q41540 Tri a 40.0101 143 409 56.7 2.4e-10
CAA35188 Hor v 1 144 287 43.2 2.7e-06
P01086 Hor v 1 144 287 43.2 2.7e-06
CAA46705 Hor v 1 148 287 43.3 2.7e-06
CAA31794 Hor v 1 147 265 40.8 1.5e-05
CAA49557 Hor v 1 171 196 33.4 0.0029
CAA35597 Tri a 30.0101 168 188 32.5 0.0054
CAA35597 Tri a TAI 168 188 32.5 0.0054
BAA07713 Ory s TAI 160 182 31.8 0.0084
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 107.7 bits 874,  Expect = 9e-26
 Identities = 120/120 100%, Positives = 120/120 100%, Gaps = 0/120 0%
Query  1    TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 60
            TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC
Sbjct  1    TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 60
Query  61   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI 120
            RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI
Sbjct  61   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI 120

Sequence Alignment: 2. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 106.7 bits 863,  Expect = 2e-25
 Identities = 119/120 99%, Positives = 119/120 99%, Gaps = 0/120 0%
Query  1    TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 60
            TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC
Sbjct  26   TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 85
Query  61   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI 120
            RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVT GHCNVMTVHNAPYCLGLDI
Sbjct  86   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNVMTVHNAPYCLGLDI 145

Sequence Alignment: 3. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 102.3 bits 823,  Expect = 5e-24
 Identities = 111/120 92%, Positives = 112/120 93%, Gaps = 0/120 0%
Query  1    TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 60
            TGPYCY GMGLP NPLEGCREYVAQQTCG+ I GS VSTEPGNTPRDRCCKELYDASQHC
Sbjct  26   TGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQHC 85
Query  61   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI 120
            RCEAVRYFIGR SDPNS VLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHN PYCLGLDI
Sbjct  86   RCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNTPYCLGLDI 145

Sequence Alignment: 4. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 99.8 bits 802,  Expect = 2e-23
 Identities = 109/120 90%, Positives = 110/120 91%, Gaps = 0/120 0%
Query  1    TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 60
            TGPYCY GMGLP NPLEGCREYVAQQTCG+ I GS VSTEPGNTPRDRCCKELYDASQHC
Sbjct  1    TGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQHC 60
Query  61   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI 120
             CEAVRYFIGR SDPNS VLKDLPGCPREPQRD AKVLVTPGHCNVMTVHN PYCLGLDI
Sbjct  61   WCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNVMTVHNTPYCLGLDI 120

Sequence Alignment: 5. Allergen Name: Hor v 1 Sequence ID: CAA49555

 Score = 95.6 bits 762,  Expect = 5e-22
 Identities = 101/120 84%, Positives = 113/120 94%, Gaps = 0/120 0%
Query  1    TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 60
            TG YCYAGMGLP NPLEGCREYVAQQTCG++I+GS VS+EPG+TP+DRCC+EL +A QHC
Sbjct  26   TGQYCYAGMGLPSNPLEGCREYVAQQTCGVTIAGSPVSSEPGDTPKDRCCQELDEAPQHC 85
Query  61   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI 120
            RCEAVRYFIGRRS P+ SVLKDLPGCP+EPQRDFAKVLVTPG+CNV+TVHNAPYCLGLDI
Sbjct  86   RCEAVRYFIGRRSHPDWSVLKDLPGCPKEPQRDFAKVLVTPGQCNVLTVHNAPYCLGLDI 145

Sequence Alignment: 6. Allergen Name: Hor v 1 Sequence ID: CAA41956

 Score = 92.4 bits 733,  Expect = 4e-21
 Identities = 98/119 82%, Positives = 110/119 92%, Gaps = 1/119 0%
Query  1    TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 60
            TG YCYAGMGLP NPLEGCREYVAQQTCG++I+GS VS+EPG+TP+DRCC+EL +A QHC
Sbjct  26   TGQYCYAGMGLPSNPLEGCREYVAQQTCGVTIAGSPVSSEPGDTPKDRCCQELDEAPQHC 85
Query  61   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI 120
            RC  VRYFIGRRS P+  VLKDLPGCP+EPQRDFAKVLVTPG+CNV+TVHNAPYCLGLDI
Sbjct  86   RCR-VRYFIGRRSHPDWRVLKDLPGCPKEPQRDFAKVLVTPGQCNVLTVHNAPYCLGLDI 144

Sequence Alignment: 7. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 60.1 bits 440,  Expect = 2e-11
 Identities = 58/109 53%, Positives = 74/109 67%, Gaps = 6/109 5%
Query  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCRCEA 64
            C      PI PL  CR+YV QQ C I   G      P    + +CC EL +  Q+CRC+A
Sbjct  30   CTPWTATPITPLPSCRDYVEQQACRIETPG------PPYLAKQQCCGELANIPQQCRCQA 83
Query  65   VRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLD 119
            +R+F+GR+S P+ S L +LPGCPRE Q DF ++LVTPG CN+ TVHN PYCL +D
Sbjct  84   LRFFMGRKSRPDQSGLMELPGCPREVQMDFVRILVTPGFCNLTTVHNTPYCLAMD 138

Sequence Alignment: 8. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 58.1 bits 422,  Expect = 9e-11
 Identities = 57/109 52%, Positives = 74/109 67%, Gaps = 6/109 5%
Query  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCRCEA 64
            C   M   I PL  CR+YV QQ C I   GS          + +CC EL +  Q+CRC+A
Sbjct  30   CTPWMSTLITPLPSCRDYVEQQACRIETPGSPY------LAKQQCCGELANIPQQCRCQA 83
Query  65   VRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLD 119
            +RYF+G +S P+ S L +LPGCPRE Q DF ++LVTPG+CN+ TVHN PYCL ++
Sbjct  84   LRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTPGYCNLTTVHNTPYCLAME 138

Sequence Alignment: 9. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 56.7 bits 409,  Expect = 2e-10
 Identities = 54/109 49%, Positives = 73/109 66%, Gaps = 6/109 5%
Query  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCRCEA 64
            C       I PL  CR YV +Q C I + G      P    +  CC++L +  Q+CRC+A
Sbjct  30   CTPWTSTLITPLPSCRNYVEEQACRIEMPG------PPYLAKQECCEQLANIPQQCRCQA 83
Query  65   VRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLD 119
            +RYF+G +S P+ S L +LPGCPRE Q +F  +LVTPG+CN+ TVHN PYCLG++
Sbjct  84   LRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGME 138

Sequence Alignment: 10. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 56.7 bits 409,  Expect = 2e-10
 Identities = 54/109 49%, Positives = 73/109 66%, Gaps = 6/109 5%
Query  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCRCEA 64
            C       I PL  CR YV +Q C I + G      P    +  CC++L +  Q+CRC+A
Sbjct  30   CTPWTSTLITPLPSCRNYVEEQACRIEMPG------PPYLAKQECCEQLANIPQQCRCQA 83
Query  65   VRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLD 119
            +RYF+G +S P+ S L +LPGCPRE Q +F  +LVTPG+CN+ TVHN PYCLG++
Sbjct  84   LRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGME 138

Sequence Alignment: 11. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 43.2 bits 287,  Expect = 3e-06
 Identities = 46/108 42%, Positives = 59/108 54%, Gaps = 10/108 9%
Query  2    GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCR 61
            G  C  G  LP NPL  CR YV  Q C     G  + T   +  + RCC EL     +CR
Sbjct  26   GDSCAPGDALPHNPLRACRTYVVSQICH---QGPRLLT---SDMKRRCCDELSAIPAYCR 79
Query  62   CEAVRYF----IGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYC 115
            CEA+R      +  +     + +KD P CPRE Q  +A  LVTP  CN+ T+H + YC
Sbjct  80   CEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTSYAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 12. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 43.2 bits 287,  Expect = 3e-06
 Identities = 46/108 42%, Positives = 59/108 54%, Gaps = 10/108 9%
Query  2    GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCR 61
            G  C  G  LP NPL  CR YV  Q C     G  + T   +  + RCC EL     +CR
Sbjct  26   GDSCAPGDALPHNPLRACRTYVVSQICH---QGPRLLT---SDMKRRCCDELSAIPAYCR 79
Query  62   CEAVRYF----IGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYC 115
            CEA+R      +  +     + +KD P CPRE Q  +A  LVTP  CN+ T+H + YC
Sbjct  80   CEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTSYAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 43.3 bits 287,  Expect = 3e-06
 Identities = 46/108 42%, Positives = 59/108 54%, Gaps = 10/108 9%
Query  2    GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCR 61
            G  C  G  LP NPL  CR YV  Q C     G  + T   +  + RCC EL     +CR
Sbjct  26   GDSCAPGDALPHNPLRACRTYVVSQICH---QGPRLLT---SDMKRRCCDELSAIPAYCR 79
Query  62   CEAVRYF----IGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYC 115
            CEA+R      +  +     + +KD P CPRE Q  +A  LVTP  CN+ T+H + YC
Sbjct  80   CEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTSYAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 14. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 40.8 bits 265,  Expect = 1e-05
 Identities = 45/101 44%, Positives = 58/101 57%, Gaps = 12/101 11%
Query  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCRCEA 64
            C  G+ +P NPL  C  YV ++ CG   S       P    ++RCC+EL     HCRCEA
Sbjct  33   CQLGVDFPHNPLATCHTYVIKRVCGRGPS------RP-MLVKERCCRELAAVPDHCRCEA 85
Query  65   VRYFIGRRSDPNSSV----LKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAP 113
            +R ++     P   V    L D   CPRE QR FA  LVT   CN+ +V+ AP
Sbjct  86   LRILMDGVRTPEGRVVEGRLGDRRDCPREEQRAFAATLVTAAECNLSSVQ-AP 137

Sequence Alignment: 15. Allergen Name: Hor v 1 Sequence ID: CAA49557

 Score = 33.4 bits 196,  Expect = 0.003
 Identities = 59/111 53%, Positives = 78/111 70%, Gaps = 20/111 18%
Query  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAV-----STE---PGNT--PRDRCCKELY 54
            C  G+ +P N L  CR+YV QQTC +   GS +     S E   PG     +  CC+EL 
Sbjct  32   CSPGVAFPTNLLGHCRDYVLQQTCAVFTPGSKLPEWMTSAELNYPGQPYLAKLYCCQELA 91
Query  55   DASQHCRCEAVRYFIG-----RRSDPNS-----SVLKDLPGCPREPQRDFAKVLVTPGHC 104
            +  Q+CRCEA+RYF+      +  DP++     S L DLPGCPRE QRDF ++LV PG+C
Sbjct  92   EIPQQCRCEALRYFMALPVPSQPVDPSTGNVGQSGLMDLPGCPREMQRDFVRLLVAPGQC 151
Query  105  NVMTVHNAPYC 115
            N+ T+HN  YC
Sbjct  152  NLATIHNVRYC 162

Sequence Alignment: 16. Allergen Name: Tri a 30.0101 Sequence ID: CAA35597

 Score = 32.5 bits 188,  Expect = 0.005
 Identities = 59/111 53%, Positives = 74/111 66%, Gaps = 20/111 18%
Query  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVST--------EPGNT--PRDRCCKELY 54
            C  G+ +  N L  CR+YV QQTCG    GS +           PG     +  CC+EL 
Sbjct  29   CVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELA 88
Query  55   DASQHCRCEAVRYFIG-----RRSDPNS-----SVLKDLPGCPREPQRDFAKVLVTPGHC 104
            + SQ+CRCEA+RYFI      +  DP S     S L DLPGCPRE Q DF ++LV PG+C
Sbjct  89   EISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQC 148
Query  105  NVMTVHNAPYC 115
            N+ T+HN  YC
Sbjct  149  NLATIHNVRYC 159

Sequence Alignment: 17. Allergen Name: Tri a TAI Sequence ID: CAA35597

 Score = 32.5 bits 188,  Expect = 0.005
 Identities = 59/111 53%, Positives = 74/111 66%, Gaps = 20/111 18%
Query  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVST--------EPGNT--PRDRCCKELY 54
            C  G+ +  N L  CR+YV QQTCG    GS +           PG     +  CC+EL 
Sbjct  29   CVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELA 88
Query  55   DASQHCRCEAVRYFIG-----RRSDPNS-----SVLKDLPGCPREPQRDFAKVLVTPGHC 104
            + SQ+CRCEA+RYFI      +  DP S     S L DLPGCPRE Q DF ++LV PG+C
Sbjct  89   EISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQC 148
Query  105  NVMTVHNAPYC 115
            N+ T+HN  YC
Sbjct  149  NLATIHNVRYC 159

Sequence Alignment: 18. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 31.8 bits 182,  Expect = 0.008
 Identities = 40/93 43%, Positives = 51/93 54%, Gaps = 21/93 22%
Query  3    PYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQH-CR 61
            P C  GMG P+ PL  CR  V +Q  G    G+A + E     RD CC++L       CR
Sbjct  40   PLCQPGMGYPMYPLPRCRALVKRQCVG---RGTAAAAE--QVRRD-CCRQLAAVDDSWCR 93
Query  62   CEAVRYFIG---RR------SDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNV 106
            CEA+ + +G   R         P S V++   GC R      A  L  P  CNV
Sbjct  94   CEAISHMLGGIYRELGAPDVGHPMSEVFR---GCRRGDLERAAASL--PAFCNV 142

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.