The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ
ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL
Sequence Info Allergen Name Length Opt Bits Score E Value
6771329 Der p 1.0121 222 1541 351.8 1e-98
6771329 Der p 1.0123 222 1532 349.8 4e-98
P08176 Der p 1 320 1526 348.3 1.6e-97
ABA39435 Der p 1.0113 302 1521 347.2 3.2e-97
6771329 Der p 1.0119 222 1517 346.5 4e-97
6771329 Der p 1.0115 222 1516 346.2 4.7e-97
6771329 Der p 1.0118 222 1516 346.2 4.7e-97
6771329 Der p 1.0117 222 1516 346.2 4.7e-97
6771329 Der p 1.0122 222 1515 346.0 5.5e-97
6771329 Der p 1.0120 222 1515 346.0 5.5e-97
6771329 Der p 1.0114 222 1514 345.8 6.4e-97
CAQ68250 Der p 1.0124 302 1512 345.2 1.3e-96
6771329 Der p 1.0116 222 1509 344.7 1.4e-96
AAC82351 Eur m 1.0101 321 1326 303.8 4.1e-84
P25780 Eur m 1.0101 321 1326 303.8 4.1e-84
AAC82352 Eur m 1.0102 321 1320 302.4 1e-83
2428875 Der f 1.0102 303 1302 298.5 1.6e-82
BAC53948 Der f 1.0101 321 1295 296.9 5e-82
2428875 Der f 1.0107 303 1294 296.7 5.4e-82
ABL84750 Der f 1.0109 321 1290 295.8 1.1e-81
ABL84749 Der f 1.0108 321 1290 295.8 1.1e-81
ABL84751 Der f 1.0110 321 1289 295.5 1.3e-81
2428875 Der f 1.0103 303 1286 294.9 1.8e-81
2428875 Der f 1.0105 303 1286 294.9 1.8e-81
P16311 Der f 1 321 1285 294.7 2.3e-81
2428875 Der f 1.0104 303 1273 292.0 1.4e-80
CAA42677 Eur m 1.0101 211 1260 289.2 6.5e-80
CAA46316 Der f 1 212 1228 282.1 9.1e-78
AAA28296 Der p 1 96 531 127.1 1.8e-31
AAK58415 Blo t 1.0101 221 483 116.1 8.7e-28
P00785 Act d 1 380 427 103.5 9.8e-24
AAQ24541 Blo t 1.0201 333 420 102.0 2.4e-23
AAA32629 Act d 1 380 419 101.7 3.4e-23
BAA21849 Ana c 2 351 410 99.7 1.2e-22
P14080 Cari p 2.0101 352 409 99.5 1.4e-22
V5LU01 Amb a 11.0101 386 407 99.0 2.2e-22
AAB09252 Gly m 1 379 381 93.2 1.2e-20
P22895 Gly m 1 379 380 93.0 1.4e-20
AAB02650 Car p papain 345 347 85.7 2e-18
ABM53753 Tyr p 1.0101 336 241 62.1 2.5e-11
P16312 Der m 1 30 145 41.6 3.3e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 1.0121 Sequence ID: 6771329

 Score = 351.8 bits 1541,  Expect = 1e-98
 Identities = 222/222 100%, Positives = 222/222 100%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222

Sequence Alignment: 2. Allergen Name: Der p 1.0123 Sequence ID: 6771329

 Score = 349.8 bits 1532,  Expect = 4e-98
 Identities = 220/222 99%, Positives = 221/222 99%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222

Sequence Alignment: 3. Allergen Name: Der p 1 Sequence ID: P08176

 Score = 348.3 bits 1526,  Expect = 2e-97
 Identities = 220/222 99%, Positives = 221/222 99%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  99   TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 158
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  159  ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 218
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  219  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 278
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  279  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 320

Sequence Alignment: 4. Allergen Name: Der p 1.0113 Sequence ID: ABA39435

 Score = 347.2 bits 1521,  Expect = 3e-97
 Identities = 219/222 98%, Positives = 220/222 99%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  81   TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 140
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  141  ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 200
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  201  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 260
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  261  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 302

Sequence Alignment: 5. Allergen Name: Der p 1.0119 Sequence ID: 6771329

 Score = 346.5 bits 1517,  Expect = 4e-97
 Identities = 219/222 98%, Positives = 220/222 99%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGI YIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIGYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 6. Allergen Name: Der p 1.0115 Sequence ID: 6771329

 Score = 346.2 bits 1516,  Expect = 5e-97
 Identities = 218/222 98%, Positives = 219/222 98%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPN QRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNTQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 7. Allergen Name: Der p 1.0118 Sequence ID: 6771329

 Score = 346.2 bits 1516,  Expect = 5e-97
 Identities = 218/222 98%, Positives = 220/222 99%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQ+RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQIRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 8. Allergen Name: Der p 1.0117 Sequence ID: 6771329

 Score = 346.2 bits 1516,  Expect = 5e-97
 Identities = 218/222 98%, Positives = 219/222 98%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREAL QTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNANKIREALTQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 9. Allergen Name: Der p 1.0122 Sequence ID: 6771329

 Score = 346.0 bits 1515,  Expect = 6e-97
 Identities = 218/222 98%, Positives = 219/222 98%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFG SNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGTSNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 10. Allergen Name: Der p 1.0120 Sequence ID: 6771329

 Score = 346.0 bits 1515,  Expect = 6e-97
 Identities = 218/222 98%, Positives = 220/222 99%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTII+RDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIRRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 11. Allergen Name: Der p 1.0114 Sequence ID: 6771329

 Score = 345.8 bits 1514,  Expect = 6e-97
 Identities = 218/222 98%, Positives = 219/222 98%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGI YIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIAYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 12. Allergen Name: Der p 1.0124 Sequence ID: CAQ68250

 Score = 345.2 bits 1512,  Expect = 1e-96
 Identities = 218/222 98%, Positives = 220/222 99%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  81   TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 140
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGC+GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  141  ELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 200
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA
Sbjct  201  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 260
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  261  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 302

Sequence Alignment: 13. Allergen Name: Der p 1.0116 Sequence ID: 6771329

 Score = 344.7 bits 1509,  Expect = 1e-96
 Identities = 217/222 97%, Positives = 220/222 99%, Gaps = 0/222 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQ+RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+QSLDLAEQ
Sbjct  1    TNACSINGNAPAEIDLRQLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PPN NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY+AVNIVGYSNA
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYYAVNIVGYSNA 180
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE YPYVVIL
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 14. Allergen Name: Eur m 1.0101 Sequence ID: AAC82351

 Score = 303.8 bits 1326,  Expect = 4e-84
 Identities = 187/222 84%, Positives = 205/222 92%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T ACSIN  + P+E+DLR +RTVTPIRMQGGCGSCWAFSGVA+TESAYLAYR+ SLDLAE
Sbjct  99   TYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAE 158
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQ+GCHGDTIPRGIEYIQ+NGVVQE YY YVAREQSC RPNAQR+G+ NYCQI
Sbjct  159  QELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQI 218
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
             PP+ NKIR+AL QTH+A+AVIIGIKDL+AFRHYDGRTI+Q DNGYQPNYHAVNIVGY N
Sbjct  219  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGN 278
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGDNGYGYFAANI+LMMIE YPYVV+L
Sbjct  279  TQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYVVML 321

Sequence Alignment: 15. Allergen Name: Eur m 1.0101 Sequence ID: P25780

 Score = 303.8 bits 1326,  Expect = 4e-84
 Identities = 187/222 84%, Positives = 205/222 92%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T ACSIN  + P+E+DLR +RTVTPIRMQGGCGSCWAFSGVA+TESAYLAYR+ SLDLAE
Sbjct  99   TYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAE 158
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQ+GCHGDTIPRGIEYIQ+NGVVQE YY YVAREQSC RPNAQR+G+ NYCQI
Sbjct  159  QELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQI 218
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
             PP+ NKIR+AL QTH+A+AVIIGIKDL+AFRHYDGRTI+Q DNGYQPNYHAVNIVGY N
Sbjct  219  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGN 278
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGDNGYGYFAANI+LMMIE YPYVV+L
Sbjct  279  TQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYVVML 321

Sequence Alignment: 16. Allergen Name: Eur m 1.0102 Sequence ID: AAC82352

 Score = 302.4 bits 1320,  Expect = 1e-83
 Identities = 187/222 84%, Positives = 204/222 91%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T ACSIN  + P+E+DLR +RTVTPIR QGGCGSCWAFSGVA+TESAYLAYR+ SLDLAE
Sbjct  99   TYACSINSVSLPSELDLRSLRTVTPIRNQGGCGSCWAFSGVASTESAYLAYRNMSLDLAE 158
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQ+GCHGDTIPRGIEYIQ+NGVVQE YY YVAREQSC RPNAQR+G+ NYCQI
Sbjct  159  QELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQI 218
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
             PP+ NKIR+AL QTH+A+AVIIGIKDL+AFRHYDGRTI+Q DNGYQPNYHAVNIVGY N
Sbjct  219  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGN 278
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGDNGYGYFAANI+LMMIE YPYVVIL
Sbjct  279  TQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYVVIL 321

Sequence Alignment: 17. Allergen Name: Der f 1.0102 Sequence ID: 2428875

 Score = 298.5 bits 1302,  Expect = 2e-82
 Identities = 184/222 82%, Positives = 202/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  81   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 140
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  141  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 200
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQRDNGYQPNYHAVNIVGY +
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQRDNGYQPNYHAVNIVGYGS 260
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  261  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303

Sequence Alignment: 18. Allergen Name: Der f 1.0101 Sequence ID: BAC53948

 Score = 296.9 bits 1295,  Expect = 5e-82
 Identities = 183/222 82%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 278
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 19. Allergen Name: Der f 1.0107 Sequence ID: 2428875

 Score = 296.7 bits 1294,  Expect = 5e-82
 Identities = 183/222 82%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  81   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 140
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  141  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQRCRRPNSQHYGISNYCQI 200
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 260
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  261  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303

Sequence Alignment: 20. Allergen Name: Der f 1.0109 Sequence ID: ABL84750

 Score = 295.8 bits 1290,  Expect = 1e-81
 Identities = 182/222 81%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            Q+LVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  159  QKLVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 278
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 21. Allergen Name: Der f 1.0108 Sequence ID: ABL84749

 Score = 295.8 bits 1290,  Expect = 1e-81
 Identities = 182/222 81%, Positives = 200/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RT TPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  99   TSACRINSVNVPSELDLRSLRTATPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 278
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 22. Allergen Name: Der f 1.0110 Sequence ID: ABL84751

 Score = 295.5 bits 1289,  Expect = 1e-81
 Identities = 182/222 81%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 23. Allergen Name: Der f 1.0103 Sequence ID: 2428875

 Score = 294.9 bits 1286,  Expect = 2e-81
 Identities = 182/222 81%, Positives = 200/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  81   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 140
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  141  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 200
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HY GRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYGGRTIIQHDNGYQPNYHAVNIVGYGS 260
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  261  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303

Sequence Alignment: 24. Allergen Name: Der f 1.0105 Sequence ID: 2428875

 Score = 294.9 bits 1286,  Expect = 2e-81
 Identities = 182/222 81%, Positives = 200/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  81   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 140
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q + ISNYCQI
Sbjct  141  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYDISNYCQI 200
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 260
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  261  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303

Sequence Alignment: 25. Allergen Name: Der f 1 Sequence ID: P16311

 Score = 294.7 bits 1285,  Expect = 2e-81
 Identities = 182/222 81%, Positives = 200/222 90%, Gaps = 1/222 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQRCRRPNSQHYGISNYCQI 218
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 278
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
             QG DYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  279  TQGDDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 26. Allergen Name: Der f 1.0104 Sequence ID: 2428875

 Score = 292.0 bits 1273,  Expect = 1e-80
 Identities = 181/221 81%, Positives = 199/221 90%, Gaps = 1/221 0%
Query  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+EQ
Sbjct  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
Query  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
Query  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
            PP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303

Sequence Alignment: 27. Allergen Name: Eur m 1.0101 Sequence ID: CAA42677

 Score = 289.2 bits 1260,  Expect = 6e-80
 Identities = 177/210 84%, Positives = 194/210 92%, Gaps = 1/210 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T ACSIN  + P+E+DLR +RTVTPIRMQGGCGSCWAFSGVA+TESAYLAYR+ SLDLAE
Sbjct  1    TYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAE 60
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQ+GCHGDTIPRGIEYIQ+NGVVQE YY YVAREQSC RPNAQR+G+ NYCQI
Sbjct  61   QELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQI 120
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
             PP+ NKIR+AL QTH+A+AVIIGIKDL+AFRHYDGRTI+Q DNGYQPNYHAVNIVGY N
Sbjct  121  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGN 180
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210
             QGVDYWIVRNSWDT WGDNGYGYFAANI+L
Sbjct  181  TQGVDYWIVRNSWDTTWGDNGYGYFAANINL 211

Sequence Alignment: 28. Allergen Name: Der f 1 Sequence ID: CAA46316

 Score = 282.1 bits 1228,  Expect = 9e-78
 Identities = 173/210 82%, Positives = 190/210 90%, Gaps = 1/210 0%
Query  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
Query  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
Query  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212

Sequence Alignment: 29. Allergen Name: Der p 1 Sequence ID: AAA28296

 Score = 127.1 bits 531,  Expect = 2e-31
 Identities = 76/78 97%, Positives = 78/78 100%, Gaps = 0/78 0%
Query  1    TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
            TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLA+R+QSLDLAEQ
Sbjct  19   TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLDLAEQ 78
Query  61   ELVDCASQHGCHGDTIPR 78
            ELVDCASQHGCHGDTIPR
Sbjct  79   ELVDCASQHGCHGDTIPR 96

Sequence Alignment: 30. Allergen Name: Blo t 1.0101 Sequence ID: AAK58415

 Score = 116.1 bits 483,  Expect = 9e-28
 Identities = 85/201 42%, Positives = 123/201 61%, Gaps = 20/201 9%
Query  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCASQ-- 68
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R Q++ L+EQEL+DC  +  
Sbjct  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
Query  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQI- 119
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
Query  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVG 176
            Y     +I+ A+   H    V+I I   +A FR+   R  I R  GY      HAV +VG
Sbjct  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVG 175
Query  177  YSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYP 217
            +    G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216

Sequence Alignment: 31. Allergen Name: Act d 1 Sequence ID: P00785

 Score = 103.5 bits 427,  Expect = 1e-23
 Identities = 75/193 38%, Positives = 104/193 53%, Gaps = 11/193 5%
Query  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCA-SQH 69
            P+ +D R    V  I+ QG CG CWAFS +A  E          + L+EQEL+DC  +Q+
Sbjct  128  PSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQN 187
Query  70   --GCHGDTIPRGIEYIQHNGVVQ-ESYYRYVAREQSCRRP--NAQRFGISNYCQIYPPNV 124
              GC+G  I  G ++I +NG +  E  Y Y A++  C     N +   I  Y  +  P  
Sbjct  188  TRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENV--PYN 245
Query  125  NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVD 184
            N+     A T+  ++V +     DAF+HY    I     G   + HAV IVGY    G+D
Sbjct  246  NEWALQTAVTYQPVSVALDAAG-DAFKHYSS-GIFTGPCGTAID-HAVTIVGYGTEGGID 302
Query  185  YWIVRNSWDTNWGDNGYGYFAANI 208
            YWIV+NSWDT WG+ GY     N+
Sbjct  303  YWIVKNSWDTTWGEEGYMRILRNV 326

Sequence Alignment: 32. Allergen Name: Blo t 1.0201 Sequence ID: AAQ24541

 Score = 102.0 bits 420,  Expect = 2e-23
 Identities = 78/192 40%, Positives = 109/192 56%, Gaps = 16/192 8%
Query  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCAS 67
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
Query  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
Query  118  QIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
            Q+   + ++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
Query  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314

Sequence Alignment: 33. Allergen Name: Act d 1 Sequence ID: AAA32629

 Score = 101.7 bits 419,  Expect = 3e-23
 Identities = 74/193 38%, Positives = 104/193 53%, Gaps = 11/193 5%
Query  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCA-SQH 69
            P+ +D R    V  I+ QG CG CWAFS +A  E          + L+EQEL+DC  +Q+
Sbjct  128  PSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQN 187
Query  70   --GCHGDTIPRGIEYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNV 124
              GC+G  I  G ++I +NG +  E  Y Y A++  C     N +   I  Y  +  P  
Sbjct  188  TRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYN 245
Query  125  NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVD 184
            N+     A T+  ++V +     DAF++Y    I     G   + HAV IVGY    G+D
Sbjct  246  NEWALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGYGTEGGID 302
Query  185  YWIVRNSWDTNWGDNGYGYFAANI 208
            YWIV+NSWDT WG+ GY     N+
Sbjct  303  YWIVKNSWDTTWGEEGYMRILRNV 326

Sequence Alignment: 34. Allergen Name: Ana c 2 Sequence ID: BAA21849

 Score = 99.7 bits 410,  Expect = 1e-22
 Identities = 72/196 36%, Positives = 109/196 55%, Gaps = 12/196 6%
Query  6    INGNA-PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVD 64
            +N +A P  ID R    V  ++ Q  CGSCW+F+ +A  E  Y       + L+EQE++D
Sbjct  118  VNISAVPQSIDWRDYGAVNEVKNQNPCGSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLD 177
Query  65   CASQHGCHGDTIPRGIEYI-QHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIYPP- 122
            CA  +GC G  + +  ++I  +NGV  E  Y Y+A + +C   NA  F  S Y   Y   
Sbjct  178  CAVSYGCKGGWVNKAYDFIISNNGVTTEENYPYLAYQGTC---NANSFPNSAYITGYSYV 234
Query  123  NVNKIREAL-AQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYS-NA 180
              N  R  + A ++  IA +I     + F++Y+G  +     G   N HA+ I+GY  ++
Sbjct  235  RRNDERSMMYAVSNQPIAALIDAS--ENFQYYNG-GVFSGPCGTSLN-HAITIIGYGQDS 290
Query  181  QGVDYWIVRNSWDTNWGDNGYGYFAANI 208
             G  YWIVRNSW ++WG+ GY   A  +
Sbjct  291  SGTKYWIVRNSWGSSWGEGGYVRMARGV 318

Sequence Alignment: 35. Allergen Name: Cari p 2.0101 Sequence ID: P14080

 Score = 99.5 bits 409,  Expect = 1e-22
 Identities = 72/184 39%, Positives = 102/184 55%, Gaps = 16/184 8%
Query  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCASQ 68
            N P  ID R    VTP++ QG CGSCWAFS +A  E          L+L+EQELVDC  +
Sbjct  134  NYPQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDKH 193
Query  69   -HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCR---RPNAQRFGISNYCQIYPPNV 124
             +GC G      ++Y+ +NGV     Y Y A++  CR   +P   +  I+ Y ++ P N 
Sbjct  194  SYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGP-KVKITGYKRV-PSNC 251
Query  125  N-KIREALAQTHSAIAVIIGIKDLDAFRH--YDGRTIIQRDNGYQPNYHAVNIVGYSNAQ 181
                  ALA    ++ V  G K +  ++   +DG    + D       HAV  VGY  + 
Sbjct  252  ETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLD-------HAVTAVGYGTSD 304
Query  182  GVDYWIVRNSWDTNWGDNGY 201
            G +Y I++NSW  NWG+ GY
Sbjct  305  GKNYIIIKNSWGPNWGEKGY 324

Sequence Alignment: 36. Allergen Name: Amb a 11.0101 Sequence ID: V5LU01

 Score = 99.0 bits 407,  Expect = 2e-22
 Identities = 66/186 35%, Positives = 103/186 55%, Gaps = 9/186 4%
Query  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDC-ASQH 69
            P ++D R+   VT ++ QGGCGSCWAF+ V A E        + + ++EQ+LVDC  +  
Sbjct  132  PDKVDWREKNAVTDVKGQGGCGSCWAFAAVVALEGINAIRTGKLVKFSEQQLVDCDMTNA 191
Query  70   GCHGDTIPRGIEY-IQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIYPP-NVNKI 127
            GC G  +     Y I+H G+  E+ Y YV + ++C +   +     +  Q  P  +   +
Sbjct  192  GCDGGLMEPAFTYVIKHGGIAPEASYPYVGKRETCDKAKIKDVLKIDGRQNVPGLDEEAL 251
Query  128  REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYS-NAQGVDYW 186
            R+A+A  H  +A   GI+      ++    +   D G +PN H V IVGY  N +G+ +W
Sbjct  252  RKAVA--HQPVAT--GIQLSGHGLQFYSEGVYTGDCGTEPN-HGVGIVGYGENEKGIKFW 306
Query  187  IVRNSWDTNWGDNGY 201
             V+NSW   WG+ GY
Sbjct  307  TVKNSWGPTWGEKGY 321

Sequence Alignment: 37. Allergen Name: Gly m 1 Sequence ID: AAB09252

 Score = 93.2 bits 381,  Expect = 1e-20
 Identities = 72/206 34%, Positives = 107/206 51%, Gaps = 11/206 5%
Query  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCASQ-H 69
            PA  D R+   +T ++ QGGCG  WAFS   A E+A+       + L+EQELVDC  +  
Sbjct  136  PASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESE 195
Query  70   GCHGDTIPRGIEYI-QHNGVVQESYYRYVAREQSCRRPNAQ-RFGISNYCQIYPPNVNKI 127
            G +     +  E++ +H G+  +  Y Y A+E  C+    Q +  I  Y  +   + +  
Sbjct  196  GSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTE 255
Query  128  REALAQTHSAI---AVIIGIKDLDAFRHYDGRTIIQRDNGYQPN--YHAVNIVGYSNAQG 182
             E      SAI    + + I D   F  Y G  I   +N   P    H V +VGY +A G
Sbjct  256  SETEQAFLSAILEQPISVSI-DAKDFHLYTG-GIYDGENCTSPYGINHFVLLVGYGSADG 313
Query  183  VDYWIVRNSWDTNWGDNGYGYFAANI-DLMMIEGYPY 218
            VDYWI +NSW  +WG++GY +   N  +L+ + G  Y
Sbjct  314  VDYWIAKNSWGEDWGEDGYIWIQRNTGNLLGVCGMNY 350

Sequence Alignment: 38. Allergen Name: Gly m 1 Sequence ID: P22895

 Score = 93.0 bits 380,  Expect = 1e-20
 Identities = 72/206 34%, Positives = 107/206 51%, Gaps = 11/206 5%
Query  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCASQ-H 69
            PA  D R+   +T ++ QGGCG  WAFS   A E+A+       + L+EQELVDC  +  
Sbjct  136  PASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESE 195
Query  70   GCHGDTIPRGIEYI-QHNGVVQESYYRYVAREQSCRRPNAQ-RFGISNYCQIYPPNVNKI 127
            G +     +  E++ +H G+  +  Y Y A+E  C+    Q +  I  Y  +   + +  
Sbjct  196  GSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTE 255
Query  128  REALAQTHSAI---AVIIGIKDLDAFRHYDGRTIIQRDNGYQPN--YHAVNIVGYSNAQG 182
             E      SAI    + + I D   F  Y G  I   +N   P    H V +VGY +A G
Sbjct  256  SETEQAFLSAILEQPISVSI-DAKDFHLYTG-GIYDGENCTSPYGINHFVLLVGYGSADG 313
Query  183  VDYWIVRNSWDTNWGDNGYGYFAANI-DLMMIEGYPY 218
            VDYWI +NSW  +WG++GY +   N  +L+ + G  Y
Sbjct  314  VDYWIAKNSWGFDWGEDGYIWIQRNTGNLLGVCGMNY 350

Sequence Alignment: 39. Allergen Name: Car p papain Sequence ID: AAB02650

 Score = 85.7 bits 347,  Expect = 2e-18
 Identities = 66/180 36%, Positives = 104/180 57%, Gaps = 20/180 11%
Query  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLD-LAEQELVDCAS 67
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R+ +L+  +EQEL+DC  
Sbjct  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
Query  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
            + +GC+G      ++ + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
Query  122  PNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQ 181
             N   +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    
Sbjct  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY---- 299
Query  182  GVDYWIVRNSWDTNWGDNGY 201
            G +Y +++NSW T WG+NGY
Sbjct  300  GPNYILIKNSWGTGWGENGY 319

Sequence Alignment: 40. Allergen Name: Tyr p 1.0101 Sequence ID: ABM53753

 Score = 62.1 bits 241,  Expect = 2e-11
 Identities = 74/207 35%, Positives = 114/207 55%, Gaps = 26/207 12%
Query  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQ-SLDLAEQELVDCAS-- 67
            P   D R +     I  QG C SCWAF+     E+AY   +++ +L L+ QELVDC +  
Sbjct  108  PKSWDWRNIIAFNSIEQQGRCSSCWAFAAATTVEAAYAHQKNKHNLHLSRQELVDCTNRT 167
Query  68   --QH----GCHGDTIPRGIEYIQHNGVVQESYYRYVAR-EQSCR-------RPNAQRFGI 113
              QH    GC G       +YI  +GV ++  Y Y     + C        + +  ++ I
Sbjct  168  FDQHYLNYGCKGGWPTEAYKYIMDHGVYEDKLYHYTETFNEVCYADKVAHDKGHPVKYYI 227
Query  114  SNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDG---RTIIQRDNGYQPNYH 170
            SNY ++   + ++   A+  T+    V I     D FR Y G   R ++   N    N H
Sbjct  228  SNYGRLAYNDTDEAIMAMLVTYGPGTVDIHGTS-DTFRFYKGGIMRNVM--PNSAYTN-H 283
Query  171  AVNIVGY-SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEG-YPYVVI 221
             V +VGY +++ GVDYWI+RNSW   WG++GYG +  + +L+     Y Y ++
Sbjct  284  IVVVVGYGTDSSGVDYWIIRNSWGKTWGEHGYGRLERHPNLLGFNNKYNYPIL 336

Sequence Alignment: 41. Allergen Name: Der m 1 Sequence ID: P16312

 Score = 41.6 bits 145,  Expect = 3e-06
 Identities = 22/29 75%, Positives = 25/29 86%, Gaps = 1/29 3%
Query  1    TNACSIN-GNAPAEIDLRQMRTVTPIRMQG 29
            T AC IN GN P+E+DLR +RTVTPIRMQG
Sbjct  1    TQACRINSGNVPSELDLRSLRTVTPIRMQG 30

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.