The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI
KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN
GVLACAIATHAKIRD
Sequence Info Allergen Name Length Opt Bits Score E Value
AAC82350 Eur m 2.0102 135 907 270.5 1.1e-74
Q9TZZ2 Eur m 2 145 906 270.2 1.5e-74
CAK22338 Der p 2.0114 146 812 242.8 2.7e-66
P49278 Der p 2 146 809 241.9 4.9e-66
ABA39437 Der p 2.0109 129 796 238.2 5.7e-65
CAQ68249 Der p 2.0115 129 794 237.6 8.6e-65
Q00855 Der f 2 146 792 236.9 1.5e-64
BAA01241 Der f 2 138 790 236.4 2.1e-64
BAA01239 Der f 2 138 786 235.2 4.8e-64
ABA39438 Der f 2.0109 129 743 222.7 2.6e-60
AAK30133 Der f 2 170 707 212.0 5.6e-57
BAX34757 Der f 35.0101 143 379 116.4 2.8e-28
A6XEN8 Blo t 2.0104 142 371 114.1 1.4e-27
A6XEN9 Blo t 2.0104 142 371 114.1 1.4e-27
CAD32314 Lep d 2.0202 141 369 113.5 2.1e-27
P80384 Lep d 2 141 369 113.5 2.1e-27
CAA58755 Lep d 2.0201 141 364 112.1 5.7e-27
CAD32313 Lep d 2.0102 141 364 112.1 5.7e-27
O02380 Tyr p 2 141 362 111.5 8.5e-27
A6XEP2 Blo t 2.0104 142 361 111.2 1e-26
A6XEP1 Blo t 2.0104 142 361 111.2 1e-26
A6XEP6 Blo t 2.0104 142 361 111.2 1e-26
A6XEP3 Blo t 2.0104 142 360 110.9 1.3e-26
AAQ73483 Blo t 2.0101 144 357 110.0 2.4e-26
CAB76459 Gly d 2.0201 125 355 109.5 2.9e-26
A6XEP5 Blo t 2.0104 142 355 109.4 3.5e-26
A6XEP4 Blo t 2.0104 142 353 108.9 5.3e-26
A6XEP0 Blo t 2.0104 142 351 108.3 7.9e-26
AAQ73482 Blo t 2.0102 142 347 107.1 1.8e-25
CAB59976 Gly d 2.0101 128 329 101.9 5.8e-24
AAQ73481 Blo t 2.0103 141 322 99.8 2.8e-23
CAA57160 Lep d 2.0101 98 281 88.1 6.5e-20
ABG76195 Der f 22.0101 155 260 81.7 8.8e-18
Q28895 Can f 7.0101 149 173 56.3 3.7e-10
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 270.5 bits 907,  Expect = 1e-74
 Identities = 135/135 100%, Positives = 135/135 100%, Gaps = 0/135 0%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
            KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  121  GVLACAIATHAKIRD 135
            GVLACAIATHAKIRD
Sbjct  121  GVLACAIATHAKIRD 135

Sequence Alignment: 2. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 270.2 bits 906,  Expect = 1e-74
 Identities = 134/135 99%, Positives = 135/135 100%, Gaps = 0/135 0%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VAAVAADQVD+KDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI
Sbjct  11   VAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 70
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
            KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN
Sbjct  71   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 130
Query  121  GVLACAIATHAKIRD 135
            GVLACAIATHAKIRD
Sbjct  131  GVLACAIATHAKIRD 145

Sequence Alignment: 3. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 242.8 bits 812,  Expect = 3e-66
 Identities = 115/135 85%, Positives = 128/135 94%, Gaps = 0/135 0%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VAAVAADQVDVKDCANHEIKKV+VPGC GSEPC+IHRG  FQLEA+F+ANQN+  AKIEI
Sbjct  12   VAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEI 71
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
            KA+IDG+E+DVPGID N CH++KCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK+LGDN
Sbjct  72   KASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDN 131
Query  121  GVLACAIATHAKIRD 135
            GVLACAIATHAKIRD
Sbjct  132  GVLACAIATHAKIRD 146

Sequence Alignment: 4. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 241.9 bits 809,  Expect = 5e-66
 Identities = 114/135 84%, Positives = 127/135 94%, Gaps = 0/135 0%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VAAVA DQVDVKDCANHEIKKV+VPGC GSEPC+IHRG  FQLEAVF+ANQN+  AKIEI
Sbjct  12   VAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEI 71
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
            KA+IDG+E+DVPGID N CH+MKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK++GD+
Sbjct  72   KASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDD 131
Query  121  GVLACAIATHAKIRD 135
            GVLACAIATHAKIRD
Sbjct  132  GVLACAIATHAKIRD 146

Sequence Alignment: 5. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 238.2 bits 796,  Expect = 6e-65
 Identities = 112/129 86%, Positives = 122/129 94%, Gaps = 0/129 0%
Query  7    DQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 66
            DQVDVKDCANHEIKKV+VPGC GSEPC+IHRG  FQLEAVF+ANQNS  AKIEIKA+IDG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  67   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACA 126
            +E+DVPGID N CH+MKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK+LGDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
Query  127  IATHAKIRD 135
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 6. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 237.6 bits 794,  Expect = 9e-65
 Identities = 111/129 86%, Positives = 122/129 94%, Gaps = 0/129 0%
Query  7    DQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 66
            DQVDVKDCANHEIKKV+VPGC GSEPC+IHRG  FQLEAVF+ANQNS  AKIEIKA+IDG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  67   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACA 126
            +E+DVPGID N CH+MKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK++GDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACA 120
Query  127  IATHAKIRD 135
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 7. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 236.9 bits 792,  Expect = 2e-64
 Identities = 113/135 83%, Positives = 124/135 91%, Gaps = 0/135 0%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VAAV ADQVDVKDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN+  AKIEI
Sbjct  12   VAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEI 71
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
            KA++DG+EIDVPGID N CHFMKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVKL+GDN
Sbjct  72   KASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDN 131
Query  121  GVLACAIATHAKIRD 135
            GVLACAIATH KIRD
Sbjct  132  GVLACAIATHGKIRD 146

Sequence Alignment: 8. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 236.4 bits 790,  Expect = 2e-64
 Identities = 113/135 83%, Positives = 124/135 91%, Gaps = 0/135 0%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VAAV ADQVDVKDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN+  AKIEI
Sbjct  4    VAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEI 63
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
            KA++DG+EIDVPGID N CHFMKCPLVKGQ+YD KYTWNVP+IAPKSENVVVTVKL+GDN
Sbjct  64   KASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDN 123
Query  121  GVLACAIATHAKIRD 135
            GVLACAIATHAKIRD
Sbjct  124  GVLACAIATHAKIRD 138

Sequence Alignment: 9. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 235.2 bits 786,  Expect = 5e-64
 Identities = 112/135 82%, Positives = 124/135 91%, Gaps = 0/135 0%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VAAV ADQVDVKDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN+  AKIEI
Sbjct  4    VAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEI 63
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
            KA++DG+EIDVPGID N CHF+KCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVKL+GDN
Sbjct  64   KASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDN 123
Query  121  GVLACAIATHAKIRD 135
            GVLACAIATH KIRD
Sbjct  124  GVLACAIATHGKIRD 138

Sequence Alignment: 10. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 222.7 bits 743,  Expect = 3e-60
 Identities = 106/129 82%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  7    DQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 66
            DQVDVKDCAN+EIKKVMV G  GS+PC+IHRG  F LEA+FDANQN+  AKIEIKA I+G
Sbjct  1    DQVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANING 60
Query  67   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACA 126
            +E+DVPGID N CHF+KCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVKL+GDNGVLACA
Sbjct  61   LEVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 120
Query  127  IATHAKIRD 135
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 11. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 212.0 bits 707,  Expect = 6e-57
 Identities = 113/135 83%, Positives = 124/135 91%, Gaps = 29/135 21%
Query  1    VAAVAADQVDVKDC-----------------------------ANHEIKKVMVPGCKGSE 31
            VAAV ADQVDVKDC                             AN+EIKKVMV GC GS+
Sbjct  7    VAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSD 66
Query  32   PCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQE 91
            PC+IHRG  F LEA+FDANQN+  AKIEIKA++DG+EIDVPGID N CHFMKCPLVKGQ+
Sbjct  67   PCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQ 126
Query  92   YDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACAIATHAKIRD 135
            YDIKYTWNVP+IAPKSENVVVTVKL+GDNGVLACAIATH KIRD
Sbjct  127  YDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170

Sequence Alignment: 12. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 116.4 bits 379,  Expect = 3e-28
 Identities = 52/131 39%, Positives = 88/131 67%, Gaps = 3/131 2%
Query  2    AAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIK 61
            A  +A ++   DC + E+  + V GC+G + CV+H+G    L+    +NQ+S   K+ I 
Sbjct  13   AVASAGKMKFVDCGHKEVISLDVSGCEG-DYCVLHKGKTIDLDMKCKSNQDSEHLKLIIS 71
Query  62   ATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNG 121
            A ++G+EI+VPG D + CH+++CP+ KGQ+YDIKY++NVP + P  +  + T K++GDNG
Sbjct  72   ADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGTL-TAKVIGDNG 130
Query  122  VLACAIATHAKIRD 135
            ++ C +  + +I D
Sbjct  131  LVGC-LKLNGEIAD 143

Sequence Alignment: 13. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 114.1 bits 371,  Expect = 1e-27
 Identities = 53/123 43%, Positives = 79/123 64%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  AA  V   DCA+ E+  + + GC G   C IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CTIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             AT++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  70   SATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 14. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 114.1 bits 371,  Expect = 1e-27
 Identities = 52/123 42%, Positives = 79/123 64%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  AA  V   DCA+ E+  + + GC G   C IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CTIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             AT++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P + P  + V  T  L+GD+
Sbjct  70   SATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 15. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 113.5 bits 369,  Expect = 2e-27
 Identities = 53/130 40%, Positives = 82/130 63%, Gaps = 3/130 2%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VA  +A ++  KDC + E+ ++ + GC G + CVIHRG    L+A F ANQ++N   I++
Sbjct  11   VAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKV 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A + G  I VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V VT +L+GD+
Sbjct  70   LAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGDH 128
Query  121  GVLACAIATHAKI 133
            GV+AC    H ++
Sbjct  129  GVMACG-TIHGQV 140

Sequence Alignment: 16. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 113.5 bits 369,  Expect = 2e-27
 Identities = 53/130 40%, Positives = 82/130 63%, Gaps = 3/130 2%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VA  +A ++  KDC + E+ ++ + GC G + CVIHRG    LEA F ANQ++    I++
Sbjct  11   VAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKV 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A + G  I VPG++ + C F+KCP+ KG+  D  Y+  +P I PK +   VT +L+GD+
Sbjct  70   LAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDH 128
Query  121  GVLACAIATHAKI 133
            GV+AC    H ++
Sbjct  129  GVMACG-TVHGQV 140

Sequence Alignment: 17. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 112.1 bits 364,  Expect = 6e-27
 Identities = 52/130 40%, Positives = 81/130 62%, Gaps = 3/130 2%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VA  +A ++  KDC + E+ ++ + GC G + CVIHRG    L+A F ANQ++N   I++
Sbjct  11   VAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKV 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A + G  I VPG++ + C  +KCP+ KG+  D  Y   +P I PK +   VT +L+GD+
Sbjct  70   LAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-ADVTAELVGDH 128
Query  121  GVLACAIATHAKI 133
            GV+AC    H ++
Sbjct  129  GVMACG-TIHGQV 140

Sequence Alignment: 18. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 112.1 bits 364,  Expect = 6e-27
 Identities = 52/130 40%, Positives = 81/130 62%, Gaps = 3/130 2%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VA  +A ++  KDC + E+ ++ + GC G + CVIHRG    LEA F ANQ++    I++
Sbjct  11   VAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKV 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
               + G  I VPG++ + C F+KCP+ KG+  D  Y+  +P I PK +   VT +L+GD+
Sbjct  70   LTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDH 128
Query  121  GVLACAIATHAKI 133
            GV+AC    H ++
Sbjct  129  GVMACG-TVHGQV 140

Sequence Alignment: 19. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 111.5 bits 362,  Expect = 8e-27
 Identities = 56/128 43%, Positives = 83/128 64%, Gaps = 7/128 5%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            VA  AA QV   DC   EI  V V GC+G + CVIH+    ++ A F ANQ++   ++++
Sbjct  10   VAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVKV 68
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLL--G 118
               ++G+E+ +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+   VKLL  G
Sbjct  69   TGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLATG 125
Query  119  DNGVLAC-AIATHAK 132
            ++GVLAC A+ T  K
Sbjct  126  EHGVLACGAVNTDVK 140

Sequence Alignment: 20. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 111.2 bits 361,  Expect = 1e-26
 Identities = 51/123 41%, Positives = 78/123 63%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 21. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 111.2 bits 361,  Expect = 1e-26
 Identities = 51/123 41%, Positives = 78/123 63%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 22. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 111.2 bits 361,  Expect = 1e-26
 Identities = 51/123 41%, Positives = 78/123 63%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 23. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 110.9 bits 360,  Expect = 1e-26
 Identities = 50/123 40%, Positives = 78/123 63%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + +  T  L+GD+
Sbjct  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTIT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 24. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 110.0 bits 357,  Expect = 2e-26
 Identities = 50/119 42%, Positives = 77/119 64%, Gaps = 2/119 1%
Query  5    AADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATI 64
            AA  V   DCA+ E+  + + GC G + C+IH+G +F L+  F ANQ+S   +I+I A +
Sbjct  17   AAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIM 75
Query  65   DGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLA 124
            + +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+GV+A
Sbjct  76   NNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVA 134
Query  125  C 125
            C
Sbjct  135  C 135

Sequence Alignment: 25. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 109.5 bits 355,  Expect = 3e-26
 Identities = 53/116 45%, Positives = 75/116 64%, Gaps = 2/116 1%
Query  8    QVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGV 67
            ++  KDC   E+ ++ +  C G + CVIHRG  + LEA F ANQ++  A I++ A + G 
Sbjct  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  68   EIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLAC 125
             I VPG++ + C F+KCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117

Sequence Alignment: 26. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 109.4 bits 355,  Expect = 4e-26
 Identities = 50/123 40%, Positives = 77/123 62%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+   A  V   DCA+ E+  + +  C G   C IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYATAGDVKFTDCAHGEVTSLDLSRCSGDH-CTIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             AT++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P + P  + V  T  L+GD+
Sbjct  70   SATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 27. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 108.9 bits 353,  Expect = 5e-26
 Identities = 50/123 40%, Positives = 78/123 63%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  AA  V   DCA+ E+  + + GC   + C+IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCS-DDHCIIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 28. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 108.3 bits 351,  Expect = 8e-26
 Identities = 50/123 40%, Positives = 77/123 62%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  AA  V   DCA+ E+  + + GC G   C+I +G +F L+  F ANQ+S   +I+I
Sbjct  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 29. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 107.1 bits 347,  Expect = 2e-25
 Identities = 49/123 39%, Positives = 76/123 61%, Gaps = 2/123 1%
Query  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
            V+  A   V    CA+ E+  + + GC G   C+IH+G +F L+  F ANQ+S   +I+I
Sbjct  11   VSPAAGGDVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIANQDSEKLEIKI 69
Query  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
Query  121  GVLAC 125
            GV+AC
Sbjct  129  GVVAC 133

Sequence Alignment: 30. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 101.9 bits 329,  Expect = 6e-24
 Identities = 48/116 41%, Positives = 79/116 68%, Gaps = 4/116 3%
Query  8    QVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG- 66
            +++  DC ++EIK++ V  C G+  CVIHRG  + L+A FDANQ++ +  + + A IDG 
Sbjct  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  67   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWN-VPRIAPKSENVVVTVKLLGDNGVLAC 125
            + ID+PG++ N C +MKCP+ KG+  ++ Y    +P   P+ +   V  +L+G++GVLAC
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119

Sequence Alignment: 31. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 99.8 bits 322,  Expect = 3e-23
 Identities = 45/111 40%, Positives = 72/111 64%, Gaps = 3/111 2%
Query  12   KDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGVEIDV 71
            + C   E+  + + GC G + C+IH+G +F L+  F ANQ+S   +I+I A ++ +E+ V
Sbjct  22   RSCT-WEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPV 79
Query  72   PGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLAC 125
            PG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+GV+AC
Sbjct  80   PGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 132

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 88.1 bits 281,  Expect = 6e-20
 Identities = 41/97 42%, Positives = 61/97 62%, Gaps = 2/97 2%
Query  35   IHRGTAFQLEAVFDANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDI 94
            IHRG    LEA F ANQ++    I++ A + G  I VPG++ + C F+KCP+ KG+  D 
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  95   KYTWNVPRIAPKSENVVVTVKLLGDNGVLACAIATHAKI 133
             Y+  +P I PK +   VT +L+GD+GV+AC    H ++
Sbjct  61   IYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQV 97

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 81.7 bits 260,  Expect = 9e-18
 Identities = 51/123 41%, Positives = 71/123 57%, Gaps = 9/123 7%
Query  2    AAVAADQVDV--KDCANHEIKKVMVPGCKGSEP-CVIHRGTAFQLEAVFDANQNS-NAAK 57
            AAV AD+ +V  KDC ++EIK   V G   ++  CVIH+ +  QL   F AN+N+ N   
Sbjct  16   AAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFVANENTGNKIN 75
Query  58   IEIKATIDGVEIDVPGIDN-NLC--HFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTV 114
                  + G+E+  PGID  + C  H + CPL KGQ Y+    +N+    P + NV  TV
Sbjct  76   TRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDDVP-TANVTATV 134
Query  115  KLL-GDNGVLAC 125
            +L  G  G L C
Sbjct  135  RLENGHGGDLLC 146

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 56.3 bits 173,  Expect = 4e-10
 Identities = 35/110 31%, Positives = 56/110 50%, Gaps = 5/110 4%
Query  9    VDVKDC--ANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 66
            V  KDC  A   IK++ V  C  ++PC +H+G ++ +   F +N  S ++K  +   + G
Sbjct  22   VHFKDCGSAVGVIKELNVNPCP-AQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLG 80
Query  67   VEIDVPGIDNNLCHF-MKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
            V +  P  + + C   + CP+ K + Y       V    P S  +VV   LLGDN
Sbjct  81   VAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYP-SIKLVVQWMLLGDN 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.