The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG
LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG
GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK
MQNHYLICNYGPAGNYLGQLPYTKK
Sequence Info Allergen Name Length Opt Bits Score E Value
P35759 Pol e 5.0101 205 1430 309.4 5e-86
Q05109 Pol a 5 209 1415 306.2 4.5e-85
AAT95009 Pol e 5.0101 226 1414 306.1 5.5e-85
P35780 Pol f 5 205 1340 290.4 2.5e-80
P81656 Pol d 5 206 1229 267.1 2.7e-73
P83377 Pol g 5 206 1226 266.5 4.2e-73
Q7Z156 Poly s 5.0101 207 1118 243.7 3e-66
C0HJV9 Poly p 5.0101 206 1117 243.5 3.4e-66
P86686 Poly p 5.0102 207 1098 239.5 5.5e-65
Q05108 Dol a 5 203 967 211.9 1.1e-56
P10737 Dol m 5.02 215 924 202.9 5.9e-54
AAA28302 Dol m 5.02 212 916 201.2 1.9e-53
P35785 Ves p 5 204 893 196.4 5.3e-52
P35787 Ves vi 5 206 884 194.5 2e-51
P35786 Ves s 5 205 883 194.3 2.3e-51
P35781 Vesp c 5 202 881 193.8 3e-51
P10736 Dol m 5.0101 227 880 193.7 3.7e-51
P0DMB9 Vesp v 5.0101 202 879 193.4 4e-51
P35784 Ves g 5 204 874 192.4 8.4e-51
Q05110 Ves v 5 227 874 192.4 8.9e-51
P35783 Ves f 5 204 869 191.3 1.7e-50
P35782 Vesp c 5 202 867 190.9 2.3e-50
P81657 Vesp m 5 202 863 190.0 4.2e-50
P35760 Ves m 5 204 856 188.6 1.2e-49
C0ITL3 Pac c 3.0101 199 636 142.3 9.9e-36
P35779 Sol r 3 211 628 140.6 3.3e-35
P35778 Sol i 3 234 606 136.1 8.7e-34
QEA69430 Sco m 5.0101 210 342 80.4 4.3e-17
AAF65314 Cte f 2 264 306 73.0 9.4e-15
7065471 Pol m 5.0101 37 244 58.8 2.5e-11
ABC58726 Sol s 3.0101 90 245 59.5 3.7e-11
AAY32926 Sol g 3.0101 70 216 53.2 2.2e-09
AAU15051 Cyn d 24.0101 153 219 54.4 2.2e-09
AAF82096 Glo m 5 259 203 51.3 3.1e-08
AVD29826 Art la 2.0101 163 198 50.0 4.9e-08
A0A2L1DGQ3 Art ar 2.0101 163 198 50.0 4.9e-08
AVD29822 Art an 2.0101 163 198 50.0 4.9e-08
AVD29824 Art ca 2.0101 163 198 50.0 4.9e-08
AVD29827 Art si 2.0101 163 198 50.0 4.9e-08
AVD29825 Art gm 2.0101 163 198 50.0 4.9e-08
XP_007199020 Pru p 9.0101 161 182 46.6 5.1e-07
ADM18345 Tab y 5.0101 256 178 46.0 1.2e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 309.4 bits 1430,  Expect = 5e-86
 Identities = 205/205 100%, Positives = 205/205 100%, Gaps = 0/205 0%
Query  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG
Sbjct  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG
Sbjct  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
Query  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
            GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK
Sbjct  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
Query  181  MQNHYLICNYGPAGNYLGQLPYTKK 205
            MQNHYLICNYGPAGNYLGQLPYTKK
Sbjct  181  MQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 2. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 306.2 bits 1415,  Expect = 5e-85
 Identities = 202/205 98%, Positives = 203/205 99%, Gaps = 0/205 0%
Query  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG
Sbjct  5    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG
Sbjct  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
Query  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
            GS LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY+EN 
Sbjct  125  GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
Query  181  MQNHYLICNYGPAGNYLGQLPYTKK 205
            MQNHYLICNYGPAGNYLGQLPYTKK
Sbjct  185  MQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 3. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 306.1 bits 1414,  Expect = 5e-85
 Identities = 202/205 98%, Positives = 204/205 99%, Gaps = 0/205 0%
Query  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            VDYCKI+CPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG
Sbjct  22   VDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG
Sbjct  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
Query  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
            GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY+ENK
Sbjct  142  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
Query  181  MQNHYLICNYGPAGNYLGQLPYTKK 205
            MQNHYLICNYGPAGNYLGQLP TKK
Sbjct  202  MQNHYLICNYGPAGNYLGQLPNTKK 226

Sequence Alignment: 4. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 290.4 bits 1340,  Expect = 3e-80
 Identities = 190/205 92%, Positives = 197/205 96%, Gaps = 0/205 0%
Query  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            VDYCKIKC SGIHTVCQYGESTKPSKNCA KVIKSVGPTEEEKKLIV+EHNRFRQKVAQG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQPAASDMN+LVWNDELAHIAQVWASQCQ LVHDKCRNTAKY VGQNIAYAG
Sbjct  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
Query  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
            GSKLPDVVSLIKLWENEVKDFNYN GITKQNF K+GHYTQM+W KTKEIGCGSLKY++N 
Sbjct  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
Query  181  MQNHYLICNYGPAGNYLGQLPYTKK 205
            MQ+HYLICNYGPAGNYLGQLPYTKK
Sbjct  181  MQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 5. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 267.1 bits 1229,  Expect = 3e-73
 Identities = 174/204 85%, Positives = 185/204 90%, Gaps = 1/204 0%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            DYCKIKC SG+HTVCQYGESTKPSKNCAGK+IKSVGPTEEEKKLIV EHNRFRQKVA+GL
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 121
            ETRGNPGPQPAAS+MN+LVWNDELA IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
Query  122  SK-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
            S  +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E  
Sbjct  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
Query  181  MQNHYLICNYGPAGNYLGQLPYTKK 205
            MQ HYLICNYGPAGNYLGQ  YTKK
Sbjct  182  MQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 6. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 266.5 bits 1226,  Expect = 4e-73
 Identities = 174/204 85%, Positives = 184/204 90%, Gaps = 1/204 0%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            DYCKIKC SG+HTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIV EHNRFRQKVAQGL
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQGL 61
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 121
            ETRGNPGPQPAAS+MN+LVWNDE A IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
Query  122  SK-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
            S  +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E  
Sbjct  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
Query  181  MQNHYLICNYGPAGNYLGQLPYTKK 205
            M+ HYLICNYGPAGNYLGQ  YTKK
Sbjct  182  MKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 7. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 243.7 bits 1118,  Expect = 3e-66
 Identities = 161/203 79%, Positives = 178/203 87%, Gaps = 2/203 0%
Query  3    YCKIKCPSGIHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            YC IKC    HTVCQYGESTKPS KNC    I SVG TEEEKKLIV EHNRFRQKVAQGL
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 62
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AG 120
            ETRGNPGPQPAASDMN+LVWNDELA+IAQVWA+QCQF+VHDKCRNTA+Y VGQNIAY A 
Sbjct  63   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSAS 122
Query  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
             +  P +VSLI LWENEVKDFNY+ GITK+NFAK+GHYTQ+VW KTKE+GCGS+KYIE  
Sbjct  123  TAAYPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKG 182
Query  181  MQNHYLICNYGPAGNYLGQLPYTKK 205
            M++HYL+CNYGPAGNY+GQ  YTKK
Sbjct  183  MKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 8. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 243.5 bits 1117,  Expect = 3e-66
 Identities = 159/203 78%, Positives = 176/203 86%, Gaps = 1/203 0%
Query  3    YCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLE 62
            YC IKC    HTVCQYGESTKPS  C    I SVG TEEEKKLIV EHNRFRQKVAQGLE
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLE 62
Query  63   TRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AGG 121
            TRGNPGPQPAASDMN+LVWNDELA+IAQVWASQCQF+VHDKCRNTA+Y VGQNIAY A  
Sbjct  63   TRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAST 122
Query  122  SKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENKM 181
            +  P +VSLI LWENEVKDFNY+ GITK+NF+K+GHYTQ+VW KTKE+GCGS+KYIE  M
Sbjct  123  AAYPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYIEKGM 182
Query  182  QNHYLICNYGPAGNYLGQLPYTKK 205
            ++HYL+CNYGPAGNY+GQ  YTKK
Sbjct  183  KSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 9. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 239.5 bits 1098,  Expect = 5e-65
 Identities = 161/203 79%, Positives = 174/203 85%, Gaps = 2/203 0%
Query  3    YCKIKCPSGIHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            YC IKC    HTVCQ GESTKPS KNCA   I SVG TEEEKKLIV EHNRFRQKVAQGL
Sbjct  3    YCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 62
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AG 120
            ETRGNPGPQPAASDMN+LVWNDELA+IAQVWASQCQF+VHDKCRNTA+Y VGQNIAY A 
Sbjct  63   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAS 122
Query  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
             +  P VV LI LWENEVKDFNYNTGITK+NFAK+GHYTQ+VW KTKE+GCGS+KYIE  
Sbjct  123  TAAYPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKG 182
Query  181  MQNHYLICNYGPAGNYLGQLPYTKK 205
            M++HYL+CNYGPAGN LG   Y  K
Sbjct  183  MKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 10. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 211.9 bits 967,  Expect = 1e-56
 Identities = 136/200 68%, Positives = 160/200 80%, Gaps = 6/200 3%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            +YCKI CP G HT+C+YG S KP  NC GK++KS G T +EK  IV  HN FRQKVAQGL
Sbjct  2    NYCKI-CPKGTHTLCKYGTSMKP--NCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGL 58
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 120
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNTAKYPVGQN+A A  
Sbjct  59   ETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFG-HDQCRNTAKYPVGQNVAIAST 117
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIEN 179
             G+    +  LIK+WE+EVKD+N +  +   NF+K+GHYTQMVWGKTKEIGCGS+KYIEN
Sbjct  118  TGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIEN 177
Query  180  KMQNHYLICNYGPAGNYLGQLPYTKK 205
            K + HYL+CNYGPAGNY+ Q  Y +K
Sbjct  178  KWHTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 11. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 202.9 bits 924,  Expect = 6e-54
 Identities = 131/201 65%, Positives = 158/201 78%, Gaps = 6/201 2%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            +YCKIKC  GIHT+C++G S KP  NC  K++K  G + +EK  IV+ HN+FRQKVA+GL
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 120
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNT KY VGQN+A A  
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFG-HDQCRNTEKYQVGQNVAIAST 128
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNTG-ITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIE 178
             G+    +  LI++WENEVKDFN   G +   NF+K+GHYTQMVWGKTKEIGCGS+KYIE
Sbjct  129  TGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 188
Query  179  NKMQNHYLICNYGPAGNYLGQLPYTKK 205
            N  + HYL+CNYGPAGNY+ Q  Y +K
Sbjct  189  NNWHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 12. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 201.2 bits 916,  Expect = 2e-53
 Identities = 130/198 65%, Positives = 156/198 78%, Gaps = 6/198 3%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            +YCKIKC  GIHT+C++G S KP  NC  K++K  G + +EK  IV+ HN+FRQKVA+GL
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 120
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNT KY VGQN+A A  
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFG-HDQCRNTEKYQVGQNVAIAST 128
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNTG-ITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIE 178
             G+    +  LI++WENEVKDFN   G +   NF+K+GHYTQMVWGKTKEIGCGS+KYIE
Sbjct  129  TGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 188
Query  179  NKMQNHYLICNYGPAGNYLGQLPY 202
            N  + HYL+CNYGPAGNY+ Q  Y
Sbjct  189  NNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 13. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 196.4 bits 893,  Expect = 5e-52
 Identities = 124/200 62%, Positives = 158/200 79%, Gaps = 7/200 3%
Query  2    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+YG S KP  NC  K++ S G T+EEK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARG 58
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQP A +M +LVWNDELA++AQVWA+QCQ+  HD CR+ AKYPVGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYPVGQNVALTG 117
Query  121  GS--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIE 178
             +  K  + V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKEIGCGS+KYI+
Sbjct  118  STADKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYIQ 177
Query  179  NKMQNHYLICNYGPAGNYLGQLPYTKK 205
            N+ + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  NEWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 14. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 194.5 bits 884,  Expect = 2e-51
 Identities = 129/202 63%, Positives = 158/202 78%, Gaps = 6/202 2%
Query  1    VDYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 59
            V+YCKIKC   G+HT C+YG STKP  NC   V+K+ G TE EK+ I+  HN FRQKVA+
Sbjct  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
Query  60   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIA-Y 118
            GLETRGNPGPQP A +MN+LVWNDELA+IAQVWASQC +  HD C++T KYPVGQNIA  
Sbjct  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKR 118
Query  119  AGGSKLPDVVS-LIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYI 177
            +  + L D    L+K+WENEVKDFN N   +K N+ K GHYTQMVW KTKEIGCGS+KY+
Sbjct  119  STTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
Query  178  ENKMQNHYLICNYGPAGNYLGQLPYTKK 205
            +++   HYL+CNYGP+GN+  +  Y KK
Sbjct  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 15. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 194.3 bits 883,  Expect = 2e-51
 Identities = 126/202 62%, Positives = 154/202 76%, Gaps = 6/202 2%
Query  1    VDYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 59
            VDYCKIKC   G+HT C+YG STKP  NC   V+KS G T+ EK+ I+  HN FR KVA+
Sbjct  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
Query  60   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYA 119
            GLETRGNPGPQP A +MN+LVWN+ELA+IAQ+WASQC++  HD C++T KY VGQNIA +
Sbjct  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVS 117
Query  120  GGSK--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYI 177
              +     +V +L+K WENEVKDFN      +  F KIGHYTQMVW KTKEIGCGS+KY+
Sbjct  118  SSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYV 177
Query  178  ENKMQNHYLICNYGPAGNYLGQLPYTKK 205
            +N    HYL+CNYGPAGN+  Q  Y +K
Sbjct  178  DNNWYTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 16. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 193.8 bits 881,  Expect = 3e-51
 Identities = 131/196 66%, Positives = 158/196 80%, Gaps = 13/196 6%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T++E   I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 121
            ETRGNPGPQP A  MN LVWNDELA+IAQVWA+QC +  HD CRN+AKY VGQNIA   G
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAE--G 116
Query  122  SKLPD----VVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYI 177
            S   D    V +++K+WE+EVKD+ Y  G  K  + K+GHYTQMVW KTKEIGCGS+KYI
Sbjct  117  STTADNFGSVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYI 174
Query  178  ENKMQNHYLICNYGPAGNYLGQLP-YTKK 205
            EN  + HYL+CNYGPAGN +G  P Y +K
Sbjct  175  ENGWHRHYLVCNYGPAGN-VGNEPIYERK 202

Sequence Alignment: 17. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 193.7 bits 880,  Expect = 4e-51
 Identities = 125/201 62%, Positives = 149/201 74%, Gaps = 5/201 2%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            +YCKIKC  GIHT+C++G S KP  NC   V+K+ G T +EK  I+  HN FRQ VA+GL
Sbjct  25   NYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 120
            ETRG PGPQP A +MN LVWNDELA IAQ WA+QC F  HD CRNTAKY VGQNIA +  
Sbjct  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDF-NHDDCRNTAKYQVGQNIAISST 141
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIEN 179
              +++     LIK WE+EV +FNY  G+   NF K+GHYTQMVWGKTKEIGCGS+KYIE+
Sbjct  142  TATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIED 201
Query  180  KMQNHYLICNYGPAGNYLGQLPYTKK 205
                HYL+CNYGP GN + Q  Y +K
Sbjct  202  NWYTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 18. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 193.4 bits 879,  Expect = 4e-51
 Identities = 129/198 65%, Positives = 158/198 79%, Gaps = 9/198 4%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T+ EK  I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGRSVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 120
            ETRGNPGPQP A  MN LVWNDELA+IAQVWASQC++  HD CRNTAKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYG-HDNCRNTAKYLVGQNIAEQST 118
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIEN 179
              + +  V +++K+W +EVKD+ Y  G +K  +  +GHYTQMVW KTKEIGCG++KYIEN
Sbjct  119  TAASFEPVSNMVKMWSDEVKDYQY--GSSKNKLNDVGHYTQMVWAKTKEIGCGNIKYIEN 176
Query  180  KMQNHYLICNYGPAGNYLGQLP-YTKK 205
              ++HYL+CNYGPAGN +G  P Y KK
Sbjct  177  GWHHHYLVCNYGPAGN-IGNEPIYEKK 202

Sequence Alignment: 19. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 192.4 bits 874,  Expect = 8e-51
 Identities = 122/200 61%, Positives = 158/200 79%, Gaps = 7/200 3%
Query  2    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+Y ES KP  NCA K + + G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKY-ESLKP--NCANKKVVAYGLTKQEKQDILKEHNDFRQKIARG 58
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKYPVGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYPVGQNVALTG 117
Query  121  GS--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIE 178
             +  K  + V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KYI+
Sbjct  118  STAAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
Query  179  NKMQNHYLICNYGPAGNYLGQLPYTKK 205
            +K + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  DKWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 20. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 192.4 bits 874,  Expect = 9e-51
 Identities = 121/200 60%, Positives = 155/200 77%, Gaps = 7/200 3%
Query  2    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+YG S KP  NC  KV+ S G T++EK+ I+ EHN FRQK+A+G
Sbjct  25   NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARG 81
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQP A +M +LVWNDELA++AQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  82   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 140
Query  121  GS--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIE 178
             +  K  D V L+K+WE+EVKD+N     +  +F K GHYTQMVW  TKE+GCGS+KYI+
Sbjct  141  STAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQ 200
Query  179  NKMQNHYLICNYGPAGNYLGQLPYTKK 205
             K + HYL+CNYGP+GN++ +  Y  K
Sbjct  201  EKWHKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 21. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 191.3 bits 869,  Expect = 2e-50
 Identities = 121/200 60%, Positives = 154/200 77%, Gaps = 7/200 3%
Query  2    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+YG S KP  NC  KV+ S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARG 58
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQP A +M +LVWNDELA++AQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDIAKYQVGQNVALTG 117
Query  121  GS--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIE 178
             +  K  D V L+K+WE+EVKD+N     +  NF K GHYTQMVW  TKE+GCGS+K+I+
Sbjct  118  STAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQ 177
Query  179  NKMQNHYLICNYGPAGNYLGQLPYTKK 205
             K + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  EKWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 22. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 190.9 bits 867,  Expect = 2e-50
 Identities = 127/198 64%, Positives = 156/198 78%, Gaps = 9/198 4%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T++E   I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 121
            ETRGNPGPQP A  MN LVWNDELA+IAQVWA+QC +  HD CRN+AKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAEGST 118
Query  122  S--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIEN 179
            S   + +V +++K+WE+EVKD+ Y  G  K  + K+GHYTQMVW KTKEIGCGS  YIE+
Sbjct  119  SADNFVNVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIED 176
Query  180  KMQNHYLICNYGPAGNYLGQLP-YTKK 205
              + HYL+CNYGPAGN +G  P Y +K
Sbjct  177  GWHRHYLVCNYGPAGN-VGNEPIYERK 202

Sequence Alignment: 23. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 190.0 bits 863,  Expect = 4e-50
 Identities = 126/198 63%, Positives = 156/198 78%, Gaps = 9/198 4%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            +YCKIKC SGIHT+C++G STKP  NC   V+K+ G T+ EK  I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKFGISTKP--NCGKNVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 121
            ETRG PGPQP A  MN LVWNDELA+IAQVWA QC +  HD CRNTAKY VGQNIA  G 
Sbjct  60   ETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYG-HDVCRNTAKYSVGQNIAENGS 118
Query  122  S--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIEN 179
            +   +  V +++++W +EVK++ Y  G TK  + ++GHYTQMVW KTKEIGCGS+KYIEN
Sbjct  119  TAASFASVSNMVQMWADEVKNYQY--GSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIEN 176
Query  180  KMQNHYLICNYGPAGNYLGQLP-YTKK 205
              + HYL+CNYGPAGN +G  P Y +K
Sbjct  177  GWHRHYLVCNYGPAGN-IGNEPIYERK 202

Sequence Alignment: 24. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 188.6 bits 856,  Expect = 1e-49
 Identities = 120/200 60%, Positives = 153/200 76%, Gaps = 7/200 3%
Query  2    DYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+YG S KP  NC  K + S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARG 58
Query  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 117
Query  121  GSK--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIE 178
             +     D V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KYI+
Sbjct  118  STAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
Query  179  NKMQNHYLICNYGPAGNYLGQLPYTKK 205
               + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  ENWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 25. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 142.3 bits 636,  Expect = 1e-35
 Identities = 96/183 52%, Positives = 131/183 71%, Gaps = 10/183 5%
Query  12   IHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQP 71
            +HT+CQY  S +PS NC      +   T  +K+ I+  HN  RQKV  G ETRGNPGPQP
Sbjct  6    VHTMCQY-TSPQPSPNCG--TYSNAHITAADKETILKVHNDERQKVKAGQETRGNPGPQP 62
Query  72   AASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGGS-KLP-DVVS 129
            AAS+M DL W++ELA IAQ W +QC+ + HD CRN  +Y VGQNIA +G + K P ++ +
Sbjct  63   AASNMPDLTWDNELAAIAQRWVNQCK-IGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  130  LIKLWENEVKDFN---YNTGITKQN-FAKIGHYTQMVWGKTKEIGCGSLKYIENKMQNHY 185
            L+++W NEV  +N    ++  +  N F KIGHYTQ+VWGKT ++GCG +++++ K    Y
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  186  LICNYGPAGNYLG 198
            L CNYGPAGN +G
Sbjct  182  LACNYGPAGNMFG 194

Sequence Alignment: 26. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 140.6 bits 628,  Expect = 3e-35
 Identities = 101/199 50%, Positives = 130/199 65%, Gaps = 15/199 7%
Query  2    DYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVA 58
            +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  59   QGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY 118
             G E RG  GPQP A  M +L W+ ELA IAQ WA+QC F  HD CRN  ++ VGQNIA 
Sbjct  59   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIAA 117
Query  119  --AGGSKLPDVVSLIKLWENEVKDFNYNTGITK-----QNFAKIGHYTQMVWGKTKEIGC 171
              + G     +  +I LW NEVKDF+ N  I+        +  +GHYTQ+VW KTK+IGC
Sbjct  118  TSSSGKNKSTLSDMILLWYNEVKDFD-NRWISSFPSDGNILMHVGHYTQIVWAKTKKIGC 176
Query  172  GSLKYIENKMQNHYLICNYGPAGNYLGQLPYTKK 205
            G + + E+    HYL+CNYGPAGN LG   Y  K
Sbjct  177  GRIMFKEDNWNKHYLVCNYGPAGNVLGAQIYEIK 210

Sequence Alignment: 27. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 136.1 bits 606,  Expect = 9e-34
 Identities = 103/197 52%, Positives = 131/197 66%, Gaps = 20/197 10%
Query  2    DYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVA 58
            +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +RQ+VA
Sbjct  24   NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 80
Query  59   QGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY 118
             G E RG  GPQP A  M +L W+ ELA IAQ WA+QC F  HD CRN  ++ VGQNIA 
Sbjct  81   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIAA 139
Query  119  AGGS----KLPDVVSLIKLWENEVKDFNYNTGITK----QN-FAKIGHYTQMVWGKTKEI 169
               S      P+   +I LW NEVKDF+ N  I+      N + K+GHYTQ+VW KT +I
Sbjct  140  TSSSGKNKSTPN--EMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTKI 196
Query  170  GCGSLKYIE-NKMQNHYLICNYGPAGNYLGQLPYTKK 205
            GCG + + E +    HYL+CNYGPAGN LG   Y  K
Sbjct  197  GCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 80.4 bits 342,  Expect = 4e-17
 Identities = 69/164 42%, Positives = 98/164 59%, Gaps = 16/164 9%
Query  30   GKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIA 89
            G  +K  G     KK+I+  HN+ RQ VA G ++    G QP+A++M +L W+D++A  A
Sbjct  23   GCDMKVRGLDANMKKMILDLHNKKRQTVANGQQS----G-QPSAANMKELHWDDQIAANA 77
Query  90   QVWASQCQFLVHDKC-RNTAKYP-VGQNIAYAGGSKLPDVVSL-IKLWENEVKDFNYNTG 146
            Q  A  C F    K  R T+KY  +G+NI Y G    PD +   +  W +EVKD      
Sbjct  78   QRSAETCVFQHTAKNLRKTSKYSYLGENI-YMG--SYPDPIPRSVNAWYDEVKDVTPAVV 134
Query  147  IT-KQNFAKIGHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPYTKK 205
             + +     IGHYTQMVW  T+ +GCG    +    +N Y+ C YGP+GNY G+ P  K+
Sbjct  135  KSFRSGGPMIGHYTQMVWANTEALGCG---LVTASDKNTYIFCQYGPSGNYPGE-PIYKQ 190

Sequence Alignment: 29. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 73.0 bits 306,  Expect = 9e-15
 Identities = 74/193 38%, Positives = 102/193 52%, Gaps = 27/193 13%
Query  2    DYCKIKCPSGIHTVCQYGESTKPS--KNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 59
            DYC + C +G +  C     TKP   ++C     K V  TE  KK  ++ HNR R+ VA 
Sbjct  33   DYCNLNCTNGPNVGC-----TKPDVPRDCQN--FKLVNITERMKKAFLNAHNRKRRLVAA 85
Query  60   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYA 119
            G     +    P A+ M +L WN  LA +A+    QC+ + HD C  T     GQN+ + 
Sbjct  86   GKGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCE-MKHD-CAKTRHGHTGQNLFFY 143
Query  120  GGSKLPDVVSLI-KL----WENEVKDFNYNTGITK-----QNFAKIGHYTQMVWGKTKEI 169
            G +  P   S I K+    W  E KD      I K      N   IGHYTQ++WG T ++
Sbjct  144  GTTLSPIKNSTIAKMAVDGWYAESKDTRLED-IKKLTTIYPNGKPIGHYTQLIWGNTTKV 202
Query  170  GCGSLKYIENKMQNHY----LICNYGPAGNYLGQLPYTKK 205
            GC    Y ++   N +    + CNY   GN L +  Y  K
Sbjct  203  GCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 30. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 58.8 bits 244,  Expect = 3e-11
 Identities = 35/37 94%, Positives = 35/37 94%, Gaps = 0/37 0%
Query  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVG 37
            VDYCKIKC SGIHTVCQYGESTKPSKNCA KVIKSVG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 31. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 59.5 bits 245,  Expect = 4e-11
 Identities = 42/86 48%, Positives = 55/86 63%, Gaps = 6/86 6%
Query  2    DYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVA 58
            +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  59   QGLETRGNPGPQPAASDMNDLVWNDELAHIAQ 90
             G E RG   PQP A  M +L W+ ELA IAQ
Sbjct  59   SGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 32. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 53.2 bits 216,  Expect = 2e-09
 Identities = 31/52 59%, Positives = 37/52 71%, Gaps = 1/52 1%
Query  154  KIGHYTQMVWGKTKEIGCGSLKYIE-NKMQNHYLICNYGPAGNYLGQLPYTKK 205
            KIGHYTQ+VW KT +IGCG + + E +    HYL+CNYGPAGN LG   Y  K
Sbjct  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69

Sequence Alignment: 33. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 54.4 bits 219,  Expect = 2e-09
 Identities = 46/141 32%, Positives = 76/141 53%, Gaps = 26/141 18%
Query  37   GPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC 96
            G  ++  + I++EHN FR K                   +  L WN  LA  +Q +A   
Sbjct  12   GLNDKAIQDILNEHNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK 54
Query  97   QFLVHDKCRNT-AKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKI 155
              L  D C+   +  P G+N+ +  G+      + +  W +E K ++Y +    Q     
Sbjct  55   --LKKD-CKMVHSDSPYGENLMFGSGA--ISWKTTVDTWSDEKKSYHYGSNTCDQG-KMC 108
Query  156  GHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202
            GHYT +VW  T  +GCG  + + +  ++  ++C+Y P GNY  Q PY
Sbjct  109  GHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQKPY 153

Sequence Alignment: 34. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 51.3 bits 203,  Expect = 3e-08
 Identities = 66/188 35%, Positives = 97/188 51%, Gaps = 26/188 13%
Query  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
            DYC + C +  H  C      +       K+I       + +  ++  HN+ R  VA G 
Sbjct  21   DYCGL-CDN--HDACVMQNVFQSGCPSGAKMID----LNKYQSALLDAHNKKRNHVAGGG 73
Query  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYP-VGQNIAYAG 120
            E++        A  M  + W+ ELA +A+    QCQ + HD+CRNT K+   GQN+A  G
Sbjct  74   ESK-----LKRACQMATMKWDSELAKLAEYNVKQCQ-MNHDRCRNTVKFKYAGQNLAELG 127
Query  121  --GSKLPDVVSLIKL----WENEVKDFNYN-TGITKQNF--AKIGHYTQMVWGKTKEIGC 171
              G   PD   LI+     W  EVKD N         N+    IGH+T MV  +   +GC
Sbjct  128  RSGGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHVGC 187
Query  172  GSLKYIE-NKMQNHYLICNYGPAGNYLGQLPYTK 204
             + +Y + N  Q   + CNY  A   + ++P  K
Sbjct  188  AASEYTKSNGFQYFLMACNY--ATTNMMEFPIYK 219

Sequence Alignment: 35. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 50.0 bits 198,  Expect = 5e-08
 Identities = 50/123 40%, Positives = 77/123 62%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
Query  106  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 165
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202
            ++ +GCG  + + +    + ++CNY P GN +GQ PY
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 50.0 bits 198,  Expect = 5e-08
 Identities = 50/123 40%, Positives = 77/123 62%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
Query  106  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 165
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202
            ++ +GCG  + + +    + ++CNY P GN +GQ PY
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 50.0 bits 198,  Expect = 5e-08
 Identities = 51/123 41%, Positives = 76/123 61%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRCGE 84
Query  106  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 165
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202
            T+ +GCG  + + +    +  +CNY P GN +GQ PY
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 50.0 bits 198,  Expect = 5e-08
 Identities = 43/109 39%, Positives = 69/109 63%, Gaps = 23/109 21%
Query  76   MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-RNTAKYPVGQNIAYAGGSKLPDVVSL 130
            M  L W+DELA +AQ WA      C ++  D+C  N A+  +  ++A             
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMA------------- 96
Query  131  IKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNY 190
            ++LW +E  D++YN     +     GHYTQ+VW  ++ +GCG  + + +    + ++CNY
Sbjct  97   VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWANSERVGCG--RALCSNGWAYIIVCNY 151
Query  191  GPAGNYLGQLPY 202
             P GN +GQ PY
Sbjct  152  DPPGNVVGQKPY 163

Sequence Alignment: 39. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 50.0 bits 198,  Expect = 5e-08
 Identities = 50/123 40%, Positives = 78/123 63%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWA----SQCQFLVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA    + C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTADCSLVHSDRCGE 84
Query  106  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 165
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202
            ++ +GCG  + + +    + ++CNY P GN +GQ PY
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 40. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 50.0 bits 198,  Expect = 5e-08
 Identities = 51/123 41%, Positives = 76/123 61%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRCGE 84
Query  106  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 165
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202
            T+ +GCG  + + +    +  +CNY P GN +GQ PY
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 41. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 46.6 bits 182,  Expect = 5e-07
 Identities = 54/140 38%, Positives = 77/140 55%, Gaps = 28/140 20%
Query  35   SVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWAS 94
            S   ++EE    V EHN+ R++V          G +P       L WN  LA+ AQ +A 
Sbjct  22   SANISKEEIDGFVEEHNKARKEV----------GNKP-------LKWNTTLAQYAQEYAD 64
Query  95   QCQFLVHDKCRNTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAK 154
            +    V D     +    G+N+  A G  +    +  K W  E K+F Y+    K    +
Sbjct  65   K---RVGDCAMEHSMGRWGENL--ASGDGMSGAAAT-KYWVTE-KEF-YDEKSNKCVKDE 116
Query  155  IGHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202
             GHY  +VWGKT E+GCG  K   N  QN Y++C+Y P      + PY
Sbjct  117  CGHYLAVVWGKTTEVGCGISKC--NNGQN-YVVCSYDPMYQPEDERPY 161

Sequence Alignment: 42. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 46.0 bits 178,  Expect = 1e-06
 Identities = 55/184 29%, Positives = 92/184 50%, Gaps = 22/184 11%
Query  1    VDYCKI-KCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 59
            +DYC + +   G H  C  G S   S +C G+  ++   T+E KK+I+ + N  R  VA+
Sbjct  24   LDYCSLCRGGRGEHVGC--G-SPGFSSDC-GQKARTRKFTKEHKKVILDKINDVRDHVAK 79
Query  60   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKY--PVGQNIA 117
            G  + G     P AS M  +VW++ELA +A+     C    + KCR+T ++  P   N  
Sbjct  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFE 132
Query  118  YAGGSKLPDVVSLIK--LWENEVKDFNYNTGITK--QNFAKIGHYTQM---VWGKTKEIG 170
            +    K+P  +SLI   +     +  N    I +  Q     G+  ++   +  +   +G
Sbjct  133  FYA-DKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVG 191
Query  171  CGSLKYIENKMQNHYLICNYGPAGNY 196
            CG   +         L CN+    +Y
Sbjct  192  CGLTTWKLGGKARALLTCNFSSENDY 217

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.