The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE
HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD
EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ
LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR
VPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASY
DTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPF
NLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVIN
EGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFA
FGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQK
EEGNKGRKGPLSSILRAFY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9FZP9 Gly m 5.0201 559 3734 857.4 0
CAA35691 Gly m conglycinin 605 2664 613.4 1.2e-176
O22120 Gly m 5.0101 543 2661 612.8 1.7e-176
AAB23463 Gly m conglycinin 439 2109 487.0 1e-138
Q198W3 Vig r 2.0101 453 1971 455.5 3.1e-129
B1NPN8 Vig r 2.0201 454 1925 445.0 4.4e-126
AAB01374 Gly m conglycinin 639 1829 423.1 2.5e-119
ACB05815 Lup an 1.0101 611 1437 333.7 1.9e-92
AAA33947 Gly m conglycinin 218 1280 298.3 3.1e-82
CAD87730 Len c 1.0101 418 1196 278.9 4.2e-76
CAD87731 Len c 1.0102 415 1179 275.0 6.1e-75
CAF25232 Pis s 1.0101 415 1158 270.2 1.7e-73
AAF18269 Jug r 2 593 1158 270.2 2.6e-73
CAF25233 Pis s 1.0102 415 1141 266.4 2.5e-72
AAM54366 Jug n 2 481 1102 257.4 1.4e-69
B3STU4 Car i 2.0101 792 1096 256.0 6.3e-69
Q9SPL4 Mac i 1.0201 666 1088 254.2 1.9e-68
Q9SPL3 Mac i 1.0101 625 1080 252.4 6.1e-68
P09801 Gos h 1 588 1004 235.1 9.3e-63
P09799 Gos h 2 605 958 224.6 1.4e-59
P43237 Ara h 1 614 723 171.0 1.9e-43
P43238 Ara h 1 626 709 167.8 1.8e-42
AAK15089 Ses i 3 585 694 164.4 1.7e-41
A0A2I4E5L6 Jug r 6.0101 502 666 158.0 1.2e-39
EF116865 Pis v 3.0101 519 593 141.4 1.3e-34
AAL86739 Cor a 11 448 497 119.5 4.2e-28
V9VGU0 Pin k 2.0101 463 492 118.4 9.6e-28
AAM73729 Ana o 1.0102 536 446 107.9 1.6e-24
AAM73730 Ana o 1.0101 538 446 107.9 1.6e-24
A0A0S3B0K0 Coc n 1.0101 490 233 59.3 6.1e-10
P09802 Gos h 3 509 182 47.7 2e-06
Q9SB11 Gly m 6.0401 563 164 43.6 3.9e-05
CAA68460 Gly m glycinin G2 485 161 42.9 5.2e-05
P04405 Gly m 6.0201 485 161 42.9 5.2e-05
P04776 Gly m 6.0101 495 161 42.9 5.4e-05
AAA33966 Gly m glycinin G1 495 161 42.9 5.4e-05
CAA26383 Tri a gliadin 296 151 40.8 0.00014
AAA34290 Tri a gliadin 296 150 40.6 0.00016
ADN39440 Pru du 6.0101 551 135 37.0 0.0037
3EHK_A Pru du 6 531 134 36.8 0.0042
BAB21619 Gly m Bd28K 473 133 36.6 0.0043
AAA34279 Tri a gliadin 313 129 35.8 0.0048
AAA34278 Tri a gliadin 319 127 35.3 0.0068
AAA34288 Tri a gliadin 251 123 34.5 0.0093
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 857.4 bits 3734,  Expect = 0
 Identities = 559/559 100%, Positives = 559/559 100%, Gaps = 0/559 0%
Query  1    VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 60
            VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE
Sbjct  1    VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 60
Query  61   HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD 120
            HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD
Sbjct  61   HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD 120
Query  121  EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ 180
            EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ
Sbjct  121  EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ 180
Query  181  LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR 240
            LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR
Sbjct  181  LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR 240
Query  241  VPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASY 300
            VPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASY
Sbjct  241  VPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASY 300
Query  301  DTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPF 360
            DTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPF
Sbjct  301  DTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPF 360
Query  361  NLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVIN 420
            NLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVIN
Sbjct  361  NLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVIN 420
Query  421  EGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFA 480
            EGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFA
Sbjct  421  EGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFA 480
Query  481  FGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQK 540
            FGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQK
Sbjct  481  FGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQK 540
Query  541  EEGNKGRKGPLSSILRAFY 559
            EEGNKGRKGPLSSILRAFY
Sbjct  541  EEGNKGRKGPLSSILRAFY 559

Sequence Alignment: 2. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 613.4 bits 2664,  Expect = 1e-176
 Identities = 466/533 87%, Positives = 502/533 94%, Gaps = 33/533 6%
Query  3    EEEECEEGQIPRPRP--QHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 60
            E+EECEEG+IPRPRP  QHPERE QQ GEKEEDE EQPRP PFPRP QP QEEEHEQ+EE
Sbjct  64   EKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRP-QPRQEEEHEQREE 122
Query  61   HEWHRKEEKHGGKGSEEE-------QDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESE 113
            +EW RKEEK G KGSEEE       QDER+ P P  PHQKEE                  
Sbjct  123  QEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERN---------------- 166
Query  114  EEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQR 173
               E++DEDEEQ +ES+ESE SE     RRHKNKNPF F S RF+TLFKNQYG +RVLQR
Sbjct  167  ---EEEDEDEEQQRESEESEDSEL----RRHKNKNPFLFGSNRFETLFKNQYGRIRVLQR 219
Query  174  FNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNL 233
            FN+RS QLQNLRDYRILEFNSKPNTLLLP+HADADYLIVILNGTAIL+LVNNDDRDSY L
Sbjct  220  FNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRL 279
Query  234  QSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSK 293
            QSGDALRVP+GTTYYVVNPDN+ENLR+ITLAIPVNKPGRFESFFLSST+AQQSYLQGFS+
Sbjct  280  QSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSR 339
Query  294  NILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTI 353
            NILEASYDTKFEEINKVLF REEGQQQGE+RLQESVIVEISK+QIR LSK AKSSSRKTI
Sbjct  340  NILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI 399
Query  354  SSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA 413
            SSEDKPFNLRSRDPIYSNKLGK+FEITPEKNPQLRDLD+FLS+VDMNEGAL+LPHFNSKA
Sbjct  400  SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKA 459
Query  414  IVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT 473
            IV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT
Sbjct  460  IVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT 519
Query  474  SDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFV 533
            S+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQELAFPGSA+ +E L+K+Q ESYFV
Sbjct  520  SNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFV 579
Query  534  DAQPQQKEEGNKGRKGPLSSILRAFY 559
            DAQP++KEEGNKGRKGPLSSILRAFY
Sbjct  580  DAQPKKKEEGNKGRKGPLSSILRAFY 605

Sequence Alignment: 3. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 612.8 bits 2661,  Expect = 2e-176
 Identities = 467/533 87%, Positives = 503/533 94%, Gaps = 33/533 6%
Query  3    EEEECEEGQIPRPRP--QHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 60
            E+EECEEG+IPRPRP  QHPERE QQ GEKEEDE EQPRP PFPRP QP QEEEHEQ+EE
Sbjct  2    EKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRP-QPRQEEEHEQREE 60
Query  61   HEWHRKEEKHGGKGSEEE-------QDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESE 113
            +EW RKEEK G KGSEEE       QDER+ P P  PHQKEE K+E              
Sbjct  61   QEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERKQE-------------- 106
Query  114  EEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQR 173
                 +DEDEEQ +ES+ESE SE     RRHKNKNPF F S RF+TLFKNQYG +RVLQR
Sbjct  107  -----EDEDEEQQRESEESEDSEL----RRHKNKNPFLFGSNRFETLFKNQYGRIRVLQR 157
Query  174  FNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNL 233
            FN+RS QLQNLRDYRILEFNSKPNTLLLP+HADADYLIVILNGTAIL+LVNNDDRDSY L
Sbjct  158  FNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRL 217
Query  234  QSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSK 293
            QSGDALRVP+GTTYYVVNPDN+ENLR+ITLAIPVNKPGRFESFFLSST+AQQSYLQGFS+
Sbjct  218  QSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSR 277
Query  294  NILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTI 353
            NILEASYDTKFEEINKVLF REEGQQQGE+RLQESVIVEISK+QIR LSK AKSSSRKTI
Sbjct  278  NILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI 337
Query  354  SSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA 413
            SSEDKPFNLRSRDPIYSNKLGK+FEITPEKNPQLRDLD+FLS+VDMNEGAL+LPHFNSKA
Sbjct  338  SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKA 397
Query  414  IVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT 473
            IV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT
Sbjct  398  IVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT 457
Query  474  SDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFV 533
            S+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQELAFPGSA+ +E L+K+Q ESYFV
Sbjct  458  SNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFV 517
Query  534  DAQPQQKEEGNKGRKGPLSSILRAFY 559
            DAQP++KEEGNKGRKGPLSSILRAFY
Sbjct  518  DAQPKKKEEGNKGRKGPLSSILRAFY 543

Sequence Alignment: 4. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 487.0 bits 2109,  Expect = 1e-138
 Identities = 317/412 76%, Positives = 372/412 90%, Gaps = 6/412 1%
Query  143  RHKNKNPFHF-NSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 201
            R    NPF+F +S  FQTLF+NQ   +R+LQRFNKRS QL+NLRDYRI++F SKPNT+LL
Sbjct  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
Query  202  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMI 261
            PHHADAD+L+ +L+G AILTLVNNDDRDSYNL+ GDA R+PAGTTYY+VNP + +NL++I
Sbjct  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
Query  262  TLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQG 321
             LAIPVNKPGR++ FFLSSTQAQQSYLQGFS NILE S+ ++FEEIN+VLFG EE     
Sbjct  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEE----- 201
Query  322  EERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITP 381
            E+R QE VIVE+SK+QIR+LS+ AKSSSRKTISSED+PFNLRSR+PIYSN +GK+FEITP
Sbjct  202  EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITP 261
Query  382  EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQE 441
            EKNPQLRDLD+FLS VD+NEGAL+LPHFNSKAIV+LVINEG+ANIELVGIKEQQQ+Q+QE
Sbjct  262  EKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQE 321
Query  442  EQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVI 501
            E+PLEV++YRAELSE D+FVIPA YP VVNATS+LNF+AFGINAENNQRNFLAG KDNV+
Sbjct  322  EEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVV 381
Query  502  SQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 559
             QI  QVQELAFPGSA+D+E L+K Q ESYFVDAQPQQKEEG+KGRKGP+ SIL A+Y
Sbjct  382  RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY 439

Sequence Alignment: 5. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 455.5 bits 1971,  Expect = 3e-129
 Identities = 293/423 69%, Positives = 369/423 87%, Gaps = 7/423 1%
Query  133  EGSESQREPRRHKNKNPFHFNS-KRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILE 191
            E  ESQ E       NPF+FNS +RF+TLFKNQYGH+RV++RF++RS+Q+QNL +YR++E
Sbjct  28   EHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVE 87
Query  192  FNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVN 251
            F SKPNTLLLPHHADAD+L+V+LNG AILTLVN D RDSY L+ G A ++PAGTT+++VN
Sbjct  88   FKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN 147
Query  252  PDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVL 311
            P++++NLR+I LAIPVN P RF++FFLSST+AQQSYL+GFSKNILEAS+D+ F+EI++VL
Sbjct  148  PNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVL 207
Query  312  FGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSN 371
            FG E  QQ+GEE  +E VIVE+ ++QIREL KHAKSSSRK +SS+D+PFNLR+ +PIYSN
Sbjct  208  FGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSN 267
Query  372  KLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGI 431
            K+G+ +EITPEKNPQL+DLDVF+S VDM EG L+LPH+NSKAIV+LVINEGEA IELVG 
Sbjct  268  KFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP 327
Query  432  KEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRN 491
             +Q    QQ+++ LEV++YRAELSE D+FVIPA YPV +NATS+LNFFAFGINAENNQRN
Sbjct  328  SDQ----QQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRN 383
Query  492  FLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEEGNKGRKG 549
            FLAG KDNV+S+IP++V +++FP S   +E LIK QSES+FVDAQP  QQ+EEG+KGRKG
Sbjct  384  FLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKG 443
Query  550  PLSSILRAFY 559
             LSSIL ++Y
Sbjct  444  SLSSILGSLY 453

Sequence Alignment: 6. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 445.0 bits 1925,  Expect = 4e-126
 Identities = 285/407 70%, Positives = 362/407 88%, Gaps = 7/407 1%
Query  143  RHKNKNPFHFNSKR-FQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 201
            R KN NPF+FNS R F+TLF+NQ+GH+RVLQRF++RS+Q+QNL +YR++E+ SKPNTLLL
Sbjct  41   RGKN-NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLL 99
Query  202  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMI 261
            PHHADAD+L+V+LNG A+LTLVN D RDS  L+ G A ++PAGTT+++VNPD++ENLR+I
Sbjct  100  PHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRII 159
Query  262  TLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQ- 320
             LA+PVN P RF+ FFLSST+AQQSYLQGFSKNILEAS+D+  +EI++VLFG EEGQQQ 
Sbjct  160  KLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFG-EEGQQQQ 218
Query  321  -GEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEI 379
             G+E  QE VIVE+ ++QIREL+KHAKSSS+K++SSED+PFNLR++ PIYSNKLG+ FEI
Sbjct  219  QGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEI 278
Query  380  TPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQ 439
            TPEKNPQLRDLD+F+  VDM EG+L+LPH+NSKAIV+LVINEG+ANIELVG +EQQ++Q+
Sbjct  279  TPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQE 338
Query  440  QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDN 499
            ++E+  EV++YRAELSE D+F+IPA YPV +NATS+LNFFAFGINAENNQRNFLAG KDN
Sbjct  339  EQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDN 398
Query  500  VISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQ--KEEGNKGRKGPL 551
            VIS+IP++V ++ FP S + ++ LIK QSES FVDAQP+Q  +EE  KG KGP+
Sbjct  399  VISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEARKGGKGPF 452

Sequence Alignment: 7. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 423.1 bits 1829,  Expect = 3e-119
 Identities = 552/558 98%, Positives = 556/558 99%, Gaps = 20/558 3%
Query  1    VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 60
            VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE
Sbjct  63   VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 122
Query  61   HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD 120
            HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD
Sbjct  123  HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD 182
Query  121  EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ 180
            EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ
Sbjct  183  EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ 242
Query  181  LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR 240
            LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR
Sbjct  243  LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR 302
Query  241  VPAGTTYYVVNPDNDENLRMI-------------------TLAIPVNKPGRFESFFLSST 281
            VPAGTT+YVVNPDNDENLRMI                   TLAIPVNKPGRFESFFLSST
Sbjct  303  VPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSST 362
Query  282  QAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIREL 341
            QAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIREL
Sbjct  363  QAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIREL 422
Query  342  SKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNE 401
            SKHAKSSSRKTISSEDKPFNL SRDPIYSNKLGKLFEIT ++NPQLRDLDVFLSVVDMNE
Sbjct  423  SKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNE 481
Query  402  GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV 461
            GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV
Sbjct  482  GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV 541
Query  462  IPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIE 521
            IPAGYPV+VNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFP SAKDIE
Sbjct  542  IPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIE 601
Query  522  NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 559
            NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY
Sbjct  602  NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639

Sequence Alignment: 8. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 333.7 bits 1437,  Expect = 2e-92
 Identities = 289/549 52%, Positives = 430/549 78%, Gaps = 28/549 5%
Query  3    EEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHE 62
            EEEE E  Q PRPR Q+ E+ER+ H  +E+ +GE  R        +  QEEEHE++ EH 
Sbjct  43   EEEEHEPRQQPRPR-QQEEQERE-HRREEKHDGEPSRGR---SQSEESQEEEHERRREHH 97
Query  63   WHRKEEKHG--GKGSEEEQDERE-HPRPHQPHQKEEEKHEWQHKQEKHQGKE-SEEEEED 118
              R++E++    +  EEE++E E +PR ++P+ + EE+ E +++Q    G +    +E  
Sbjct  98   REREQEQQPRPQRRQEEEEEEEEWQPRRQRPQSRREEREEREQEQGSSSGSQRGGGDERR 157
Query  119  QDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRS 178
            Q  +    +E +E E  +S+ + RR++  NP+HF+S RFQT ++N+ G++RVL+RFN+R+
Sbjct  158  QHRERRVHREEREQE-QDSRSDSRRQR--NPYHFSSNRFQTYYRNRNGQIRVLERFNQRT 214
Query  179  QQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA 238
             +L+NL++YRI+EF SKPNTL+LP H+DAD+++V+LNG A +T+VN D R  YNL+ GDA
Sbjct  215  NRLENLQNYRIIEFQSKPNTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDA 274
Query  239  LRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEA 298
            LR+PAGTT Y++NPD+++NLR+  LAIP+N PG++  F+ S+T+ QQSY+ GFSKN LEA
Sbjct  275  LRLPAGTTSYILNPDDNQNLRVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEA 334
Query  299  SYDTKFEEINKVLFGREE-----GQQQGEERLQ--ESVIVEISKKQIRELSKHAKSSSRK 351
            +++T++EEI +VL+G +E      Q++G+E+ +  E VIV +SKKQI+EL KHA+SSS +
Sbjct  335  TFNTRYEEIERVLLGDDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGE 394
Query  352  TISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNS 411
               SE  PFNLRS  PIYSNK+G ++EITP+ NPQ++DL++ L+  ++NEGAL+LPH+NS
Sbjct  395  GKPSESGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNS 454
Query  412  KAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLE-----VRKYRAELSEQDIFVIPAGY 466
            KAI ++V++EGE N ELVGI++QQ++Q ++E+  E     VR+Y  +LS+ D+F+IPAG+
Sbjct  455  KAIFIVVVDEGEGNYELVGIRDQQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGH 514
Query  467  PVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKS 526
            P+ +NA+S+L ++ FGINA  NQRNFLAGS+DNVI Q+  +V+EL FPGS +D+E LIK+
Sbjct  515  PLSINASSNLRLLGFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKN 574
Query  527  QSESYFVDAQPQQKE----EGNKGRKGPLSSILRAFY 559
            Q +SYF +AQPQQ++    EG +GR+GP+SSIL A+Y
Sbjct  575  QQQSYFANAQPQQQQQREKEGRRGRRGPISSILNALY 611

Sequence Alignment: 9. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 298.3 bits 1280,  Expect = 3e-82
 Identities = 195/218 89%, Positives = 209/218 95%, Gaps = 0/218 0%
Query  342  SKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNE 401
            SK AKSSSRKTISSEDKPFNL SRDPIYS KLGK+FEITPEKNPQLRDLD+FLS+VDMNE
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  402  GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV 461
            GAL+LPHFNSKAIV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKYRAELSEQDIFV
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
Query  462  IPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIE 521
            IPAGYPVVVNATS+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQELAFPGSA+ +E
Sbjct  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
Query  522  NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 559
             L+K+Q ESYFVDAQP +KEEGNKGRKGPLSSILRAFY
Sbjct  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218

Sequence Alignment: 10. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 278.9 bits 1196,  Expect = 4e-76
 Identities = 230/399 57%, Positives = 337/399 84%, Gaps = 18/399 4%
Query  143  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 202
            R   +NPF F S RFQT+++N+ GH+R+LQRF+KRS+ ++NL++YR+LE+ SKP+T++LP
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
Query  203  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMIT 262
            +  DAD+++V+L+G AILT++N++DR+S+NL+ GD +++PAGT  Y+ N D++E+LR++ 
Sbjct  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  263  LAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGE 322
            LAIPVN+PG+++SF+LS TQ Q S+L GFSKNILEA+++T++EEI KVL+  +E + Q  
Sbjct  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
Query  323  ERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 374
              L+        E VIV++S++QI ELSK+AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
Query  375  KLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIK-E 433
            K+FEITPEKNPQL+DLD+F++ V++ EG+L+LP++NS+AIV++ +NEG+ + ELVG + E
Sbjct  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
Query  434  QQQRQ---------QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGIN 484
             QQ Q         Q+EE   +V++YRA LS  D++VIPAG+PV +NA+SDLN+  FGIN
Sbjct  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGIN 361
Query  485  AENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKE 541
            A+NNQRNFLAG +DNVISQI   V+ELAFPGS+++++ L+ +Q +S+F +AQP Q E
Sbjct  362  AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418

Sequence Alignment: 11. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 275.0 bits 1179,  Expect = 6e-75
 Identities = 226/399 56%, Positives = 338/399 84%, Gaps = 15/399 3%
Query  143  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 202
            R   +NPF F S RFQT+++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP+TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  203  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMIT 262
            ++ DAD+++V+L+G A+LT++N++DR+S+NL+ GD +++PAGT  Y+ N D++E+LR++ 
Sbjct  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  263  LAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGE 322
            LAIPVN PG++ESF+LS TQ Q S+L GF+K+ILEA+++T +EEI KVL+  +E + Q  
Sbjct  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
Query  323  ERL--------QESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 374
              L        +E+VIV++S++QI+ELSK+AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
Query  375  KLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQ 434
            K+FEITPEKNPQL+DLD+F++ V++ EG+L+LP++NS+AIV++ +NEG+   ELVG + +
Sbjct  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
Query  435  QQRQ-------QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAEN 487
             QR+       Q+EE   +V++YRA+LS  D+FV+PAG+PV +NA+SDLN+  FGINA+N
Sbjct  302  NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKN 361
Query  488  NQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKE 541
            NQRNFLAG +DNVISQI   V+ELAFPGS+++++ L+ +Q +S+F +AQP Q E
Sbjct  362  NQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415

Sequence Alignment: 12. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 270.2 bits 1158,  Expect = 2e-73
 Identities = 229/399 57%, Positives = 334/399 83%, Gaps = 15/399 3%
Query  143  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 202
            R   +NPF F S RFQTL++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP+TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  203  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMIT 262
            ++ DAD+++V+L+G A LT++ ++DR+S+NL+ GDA+++PAGT  Y+ N D++E+LR++ 
Sbjct  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
Query  263  LAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGE 322
            LAIPVNKPG+++SF+LS TQ Q S L GFSKNILEA+++T +EEI KVL+ ++E + Q  
Sbjct  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
Query  323  ERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 374
              L+        E+VIV++S++QI ELSK+AKSSS+K++SSE  PFNLRSR+PIYSNK+G
Sbjct  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
Query  375  KLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQ 434
            K+FEITPEKN QL+DLD+F++ VD+ EG+L+LP++NS+AIV++ + EG+ + ELVG + +
Sbjct  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
Query  435  QQ-------RQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAEN 487
             Q        +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+SDLN+  FGINAEN
Sbjct  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAEN 361
Query  488  NQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKE 541
            N+RNFLAG +DNVISQ+   V+ELAFPGS+ +++ L+K+Q +SYF +AQP Q+E
Sbjct  362  NERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 13. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 270.2 bits 1158,  Expect = 3e-73
 Identities = 206/543 37%, Positives = 349/543 64%, Gaps = 42/543 7%
Query  4    EEECE-EGQIPRPRPQHP----ERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQK 58
            +E C  +GQ  R + Q      ER  + +  +EE E  + R      PR P Q  E+ Q+
Sbjct  22   QEYCRRQGQGQRQQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQRYEQCQQ 81
Query  59   EEHEWHRKEEKHGGKGSEEE---QDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEE 115
            +     R +E+   +   E+   Q+ERE  R    +  +++ H  Q ++ + Q +  E +
Sbjct  82   QCERQRRGQEQTLCRRRCEQRRQQEERERQRGRDRQDPQQQYHRCQ-RRCQIQEQSPERQ 140
Query  116  EEDQDEDEEQDKESQESE-GSES--QREPR----RHKNKNPFHFNSKRFQTLFKNQYGHV 168
             + Q   E Q KE Q  E G E+  +RE R     ++  NP++F+S+  ++  +++ G V
Sbjct  141  RQCQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV 200
Query  169  RVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDR 228
            + L+RF +R++ L+ + +YR++ +++ PNT +LPHH DA+ + V+  G A LTLV+ + R
Sbjct  201  KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETR 260
Query  229  DSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQA-QQSY 287
            +S+NL+ GD +RVPAG T YV+N D++E L M+ L  PVN PG+F  ++ +  ++  QSY
Sbjct  261  ESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSY 320
Query  288  LQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKS 347
            L+ FS +IL A+ +T  + + + +        Q E+R  E VI+  S++++R LS+HA S
Sbjct  321  LRVFSNDILVAALNTPRDRLERFF-------DQQEQR--EGVIIRASQEKLRALSQHAMS 371
Query  348  SSRKTIS--SEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALF 405
            + ++     S   P +L+S  P YSN++G++FE  PE++ QL+++DV+++  ++  GA+ 
Sbjct  372  AGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMM 431
Query  406  LPHFNSKAIVVLVINEGEANIELV-------GIKEQQQRQQQEEQPL-EVRKYRAELSEQ 457
            +PH+NSKA VV+ + EG    E+          + Q +R+Q+EE+     +K  A L+  
Sbjct  432  VPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARG 491
Query  458  DIFVIPAGYPVVVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPG 515
            DIFVIPAG+P+ + A+ + N+  + F IN ENNQR+FLAG ++N+I+Q+  + +EL+F  
Sbjct  492  DIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-QNNIINQLEREAKELSFNM 550
Query  516  SAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILR-AFY 559
              ++IE + +SQ ESYFV  + Q +    +GR  PL+SIL  AF+
Sbjct  551  PREEIEEIFESQMESYFVPTERQSRR--GQGRDHPLASILDFAFF 593

Sequence Alignment: 14. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 266.4 bits 1141,  Expect = 2e-72
 Identities = 227/399 56%, Positives = 330/399 82%, Gaps = 15/399 3%
Query  143  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 202
            R   +NPF F S RFQTL++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLP 61
Query  203  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMIT 262
            +  DAD+++V+L+G A LT++ ++DR+S+NL+ GD +++PAGT  Y+ N D++E+LR++ 
Sbjct  62   QCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  263  LAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGE 322
            L IPVNKPG+++SF+LS TQ Q S L GFSKNILEA+++T +EEI KVL+ ++E + Q  
Sbjct  122  LTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
Query  323  ERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 374
              L+        E+VIV++S++QI ELSK+AKSSS+K++SSE  PFNLRSR+PIYSNK+G
Sbjct  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
Query  375  KLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQ 434
            K+FEITPEKN QL+DLD+F++ VD+ EG+L+LP++NS+AIV++ + EG+ + ELVG + +
Sbjct  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
Query  435  QQ-------RQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAEN 487
             Q        +Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+SDLN+  FGINAEN
Sbjct  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAEN 361
Query  488  NQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKE 541
            N+RNFLAG +DNVISQ+   V+ELAFPGS+ +++ L+K+Q +SYF +AQP Q+E
Sbjct  362  NERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 15. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 257.4 bits 1102,  Expect = 1e-69
 Identities = 175/466 37%, Positives = 311/466 66%, Gaps = 26/466 5%
Query  82   REHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREP 141
            R+   P+Q +++ + + + Q +  + Q +  +  E    E + +++  + S   ES+   
Sbjct  2    RDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESKGRE 61
Query  142  RRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 201
              ++  NP++F+S+  ++  +++ G V+ L+RF +R++ L+ + +YR++ +++ PNT++L
Sbjct  62   EEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFML 121
Query  202  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMI 261
            PHH DA+ +IV+  G A LTLV+ + R+S+NL+ GD +RVPAG T YV+N D++E L M+
Sbjct  122  PHHKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMV 181
Query  262  TLAIPVNKPGRFESFFLSSTQA-QQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQ 320
             L  PVN PG+   ++ +  ++  QSYL+ FS +IL A+ +T  + + + +        Q
Sbjct  182  KLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF-------DQ 234
Query  321  GEERLQESVIVEISKKQIRELSKHAKSSSRKTIS--SEDKPFNLRSRDPIYSNKLGKLFE 378
             E+R  E VI+  S++++R LS+HA S+ ++     S   P +L+S  P YSN++G++FE
Sbjct  235  QEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFE 292
Query  379  ITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV-------GI 431
              PE++ QL+++DV+++  ++  GA+ +PH+NSKA VV+ + EG    E+          
Sbjct  293  ACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSF 352
Query  432  KEQQQRQQQEEQPL-EVRKYRAELSEQDIFVIPAGYPVVVNATSDLNF--FAFGINAENN 488
            ++Q +R+Q+EE+     +K  A L+  DIFVIPAG+P+ + A+ + N+  + FGIN ENN
Sbjct  353  EDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENN 412
Query  489  QRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRK 548
            QRNFLAG ++++I+Q+  + +EL+F    ++IE + +SQ ESYFV  + Q +    +GR 
Sbjct  413  QRNFLAG-QNSIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR--GQGRD 469
Query  549  GPLSSILR-AFY 559
             PL+SIL  AF+
Sbjct  470  HPLASILGFAFF 481

Sequence Alignment: 16. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 256.0 bits 1096,  Expect = 6e-69
 Identities = 198/540 36%, Positives = 349/540 64%, Gaps = 41/540 7%
Query  4    EEECE-EGQIPRPRPQHP----ERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQK 58
            +E C  +GQ  R + Q      ER  +++ ++EE E  + R      PR P Q  E+ Q+
Sbjct  218  QEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQEERERRRGRDEDDQNPRDPEQRYEQCQQ 277
Query  59   EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEED 118
            +     R +E++  +   E+Q ++E    ++   +++ +++++  Q + Q +E   E + 
Sbjct  278  QCERQRRGQEQQLCRRRCEQQRQQEERERQRGRDRQDPQQQYHRCQRRCQTQEQSPERQR 337
Query  119  QDED--EEQDKESQESEGSESQREPRR--------HKNKNPFHFNSKRFQTLFKNQYGHV 168
            Q +   E Q KE Q  E    Q  PRR        ++  NP++F+S+ +++  ++  G V
Sbjct  338  QCQQRCERQYKEQQGREWGPDQASPRRESRGREEEQQRHNPYYFHSQGLRSRHESGEGEV 397
Query  169  RVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDR 228
            + L+RF +R++ L+ + +YR++ + + PNT++LP+H DA+ +IV+  G A LT+V+ + R
Sbjct  398  KYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVVTRGRATLTFVSQERR 457
Query  229  DSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYL 288
            +S+NL+ GD +RVPAG T YV+N D++E L M+ L  PVN PG+F  ++ +  Q+ +SYL
Sbjct  458  ESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAQSTESYL 517
Query  289  QGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSS 348
            + FS +IL A+ +T  + + + +        Q E+R  E VI+  S++++R LS+HA S+
Sbjct  518  RVFSNDILVAALNTPRDRLERFF-------DQQEQR--EGVIIRASQEKLRALSQHAMSA 568
Query  349  SRKTIS--SEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFL 406
             ++     S   P +L+S+   YSN++G++FE  PE++ QL+++DV+++  ++  GA+ +
Sbjct  569  GQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMV 628
Query  407  PHFNSKAIVVLVINEGEANIELV---GIKEQQ-----QRQQQEEQPL--EVRKYRAELSE 456
            PH+NSKA VV+ + EG    E+     +  Q      +R+Q+EE+    + +K  A L+ 
Sbjct  629  PHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLAR 688
Query  457  QDIFVIPAGYPVVVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFP 514
             DIFVIPAG+P+ + A+ + N+    FGIN +NNQRNFLAG ++N+I+Q+  + +EL+F 
Sbjct  689  GDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAG-QNNIINQLEREAKELSFN 747
Query  515  GSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSIL 555
               ++IE + + Q ESYFV  + Q +    +GR  PL+SIL
Sbjct  748  MPREEIEEIFERQVESYFVPMERQSRR--GQGRDHPLASIL 786

Sequence Alignment: 17. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 254.2 bits 1088,  Expect = 2e-68
 Identities = 193/533 36%, Positives = 335/533 62%, Gaps = 41/533 7%
Query  4    EEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEW 63
            +E CEE +    R + P+++ +Q  E+ +    +PR     +  Q   E  +E+++  + 
Sbjct  107  KEICEEEE-EYNRQRDPQQQYEQCQERCQRHETEPRHM---QTCQQRCERRYEKEKRKQQ 162
Query  64   HRKEEKHGGKGSEEEQDER--EHPRPHQPHQKEEE----KHEWQHKQEKHQGKESEEEEE 117
             R EE++  +  EE+ +ER  E      P+Q+E E    + E Q  ++++Q +    E++
Sbjct  163  KRYEEQQ--REDEEKYEERMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQ 220
Query  118  DQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKR 177
             Q      D  + +  GS    E    ++ NP++F+ + + T F+ + GH+ VL+ F  R
Sbjct  221  RQ-HGRGGDLINPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGR 279
Query  178  SQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGD 237
            S+ L+ L++YR++ + + PN ++LP H DAD ++++  G   L +++ D+R+SYNL+ GD
Sbjct  280  SKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGD 339
Query  238  ALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILE 297
             +R+PAGTT+Y++N DN+E L +  +   ++ PG+++ FF +  Q  + YL  FSK ILE
Sbjct  340  VIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILE 399
Query  298  ASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS--- 354
            A+ +T+ E +  VL     GQQ+      E VI+  S++QIREL++    S R  I    
Sbjct  400  AALNTQAERLRGVL-----GQQR------EGVIISASQEQIRELTRDDSESRRWHIRRGG 448
Query  355  -SEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA 413
             S   P+NL ++ P+YSNK G+ +E+ PE   QL+D+DV + + ++ +G++  P FN+++
Sbjct  449  ESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRS 508
Query  414  IVVLVINEGEANIELV--------GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAG 465
              V+V+  GEA++E+         G +   +R+++EE  +   + +A LS+++  V+P G
Sbjct  509  TKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEED-VHYEQVKARLSKREAIVVPVG 567
Query  466  YPVVVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENL 523
            +PVV  ++ + N+  FAFGINA+NN+ NFLAG + NV+ QI  Q  ELAF    K++E L
Sbjct  568  HPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEEL 627
Query  524  IKSQSESYFVDAQPQQKEEGNKGRKG--PLSSIL 555
              SQ ES F     Q++++ ++  K   PL SIL
Sbjct  628  FNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661

Sequence Alignment: 18. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 252.4 bits 1080,  Expect = 6e-68
 Identities = 196/533 36%, Positives = 338/533 63%, Gaps = 41/533 7%
Query  4    EEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEW 63
            +E CEE +    R + P+++ +Q  ++ +    +PR     + R    E  +E+++  + 
Sbjct  66   KEICEEEE-EYNRQRDPQQQYEQCQKRCQRRETEPRHMQICQQRC---ERRYEKEKRKQQ 121
Query  64   HRKEEKHGGKGSEEEQDER--EHPRPHQPHQKEEE---KH-EWQHKQEKHQGKESEEEEE 117
             R EE++  +  EE+ +ER  E      P+Q+E E   +H E Q  + ++Q +   +E++
Sbjct  122  KRYEEQQ--REDEEKYEERMKEGDNKRDPQQREYEDCRRHCEQQEPRLQYQCQRRCQEQQ 179
Query  118  DQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKR 177
             Q      D  + +  GS    E    ++ NP++F+ + + T F+ + GH+ VL+ F  R
Sbjct  180  RQ-HGRGGDLMNPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGR 238
Query  178  SQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGD 237
            S+ L+ L++YR++ + + PN ++LP H DAD +++++ G   L +++ D+R+SYNL+ GD
Sbjct  239  SKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGD 298
Query  238  ALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILE 297
             +R+PAGTT+Y++N DN+E L +  +   ++ PG+++ FF +  Q  + YL  FSK ILE
Sbjct  299  VIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILE 358
Query  298  ASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS--- 354
            A+ +T+ E +  VL     GQQ+      E VI+  S++QIREL++    S R  I    
Sbjct  359  AALNTQTERLRGVL-----GQQR------EGVIIRASQEQIRELTRDDSESRRWHIRRGG 407
Query  355  -SEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA 413
             S   P+NL ++ P+YSNK G+ +E+ PE   QL+D+DV + + ++ +G++  P FN+++
Sbjct  408  ESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRS 467
Query  414  IVVLVINEGEANIELV--------GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAG 465
              V+V+  GEA++E+         G +   +R+++EE+ +   + RA LS+++  V+ AG
Sbjct  468  TKVVVVASGEADVEMACPHLSGRHGGRGGGKRHEEEEE-VHYEQVRARLSKREAIVVLAG 526
Query  466  YPVVVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENL 523
            +PVV  ++ + N+  FAFGINA+NN+ NFLAG + NV+ QI  Q  ELAF  S K++E L
Sbjct  527  HPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVEEL 586
Query  524  IKSQSESYFVDA--QPQQKEEGNKGRKGPLSSIL 555
              SQ ES F     Q QQ+   +  ++ PL SIL
Sbjct  587  FNSQDESIFFPGPRQHQQQSPRSTKQQQPLVSIL 620

Sequence Alignment: 19. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 235.1 bits 1004,  Expect = 9e-63
 Identities = 198/517 38%, Positives = 331/517 64%, Gaps = 43/517 8%
Query  7    CE---EGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEW 63
            CE    GQ  + + Q  E  + Q+GEK++ +  +P     P+ R    ++E  Q+EE + 
Sbjct  48   CEWDTRGQ--KEQQQCEESCKSQYGEKDQQQRHRPED---PQRRYEECQQECRQQEERQR 102
Query  64   HRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDE 123
             + +++   +  +E+Q  + + +  Q H  ++E+   + +Q   + +E  +E   + E E
Sbjct  103  PQCQQRCLKRFEQEQQQSQRQFQECQQHCHQQEQRPERKQQCVRECRERYQENPWRRERE 162
Query  124  EQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQN 183
            E+ +E +  EG + Q       + NPFHF+ + FQ+ F+ ++G+ RVLQRF  R   L+ 
Sbjct  163  EEAEEEETEEGEQEQ-------SHNPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRG 215
Query  184  LRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPA 243
            + ++R+  + + PNT++LPHH DA+ + ++ NG   LT++ +++++SYN+  G  +RVPA
Sbjct  216  INEFRLSILEANPNTFVLPHHCDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPA 275
Query  244  GTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTK 303
            G+T Y+ N DN E L +  L  PVN P +FE FF + +Q  QSYL+ FS+ ILE +++T+
Sbjct  276  GSTVYLANQDNKEKLIIAVLHRPVNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTR 335
Query  304  FEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLR 363
             E++++ LFG   G+Q    +  + +  + S++QIR LS+ A S   K  S E   FNL 
Sbjct  336  SEQLDE-LFG---GRQSHRRQQGQGMFRKASQEQIRALSQEATSPREK--SGERFAFNLL 389
Query  364  SRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGE 423
             R P YSN+ G+++E  P +  QL D++V +S + +N+G++F+PH+NSKA  V+++NEG 
Sbjct  390  YRTPRYSNQNGRFYEACPREFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGN 449
Query  424  ANIELVGI-----------KEQQQRQQQEEQ--PLEVRKYRAELSEQDIFVIPAGYPVVV 470
              +E+V             +EQQQ Q+QEE+    + RK R++LS  DIFV+PA +PV  
Sbjct  450  GYVEMVSPHLPRQSSFEEEEEQQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTF 509
Query  471  NATSDLNF--FAFG-----INAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENL 523
             A+ + N+    FG     IN ++NQR F+AG K N + Q  SQ +ELAF  S++ ++ +
Sbjct  510  VASQNQNLRMTGFGLYNQNINPDHNQRIFVAG-KINHVRQWDSQAKELAFGVSSRLVDEI 568
Query  524  IKSQ-SESYFVDAQPQQKEE 542
              +   ESYFV  Q Q+  E
Sbjct  569  FNNNPQESYFVSRQRQRASE 588

Sequence Alignment: 20. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 224.6 bits 958,  Expect = 1e-59
 Identities = 188/514 36%, Positives = 338/514 65%, Gaps = 44/514 8%
Query  21   ERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQD 80
            +R   Q  E+++ +GE P+       R+ +   +H Q+EE    R+   H  +   E+ +
Sbjct  63   DRSETQLKEEQQRDGEDPQ-------RRYQDCRQHCQQEE----RRLRPHCEQSCREQYE 111
Query  81   EREHPRPHQPHQKEEEKHEWQHKQ-EKHQG--KESEEE-EEDQDEDEEQDKESQESEGSE 136
            ++++ +P +  ++ +++ +WQ ++ E+ Q   KE  E+ +ED  + E ++K  +E E  E
Sbjct  112  KQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEE--E 169
Query  137  SQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKP 196
               E  +++  NP++F+ + FQ  F+ ++G+ RVLQRF  + + L+ + ++RI  + + P
Sbjct  170  ESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANP 229
Query  197  NTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDE 256
            NT++LPHH DA+ + V+ NG   +T+V +++++SYN+  G  +R+PAG+T Y+ N DN E
Sbjct  230  NTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNRE 289
Query  257  NLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREE 316
             L +  L  PVN PG+F+ FF +  +  QSYL+ FS+ ILEA ++T+ E+++++  GR+ 
Sbjct  290  KLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQS 349
Query  317  GQ-QQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGK 375
             + QQG+  ++++     S++QIR LS+ A S   K   SE   FNL S+ P YSN+ G+
Sbjct  350  HRRQQGQGMFRKA-----SQEQIRALSQGATSPRGK--GSEGYAFNLLSQTPRYSNQNGR 402
Query  376  LFEITPEK-NPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV--GIK 432
            ++E  P     QLR++D  +   ++N+G++F+PH+NSKA  V+++ EG  ++E+V   + 
Sbjct  403  FYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLS 462
Query  433  EQ------QQRQQQEEQPLEVR-----KYRAELSEQDIFVIPAGYPV--VVNATSDLNFF 479
             Q      ++ ++QEEQ +E R     + RA+LS  ++FV+PAG+PV  V +   DL ++
Sbjct  463  RQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLL 522
Query  480  AFGI-NAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQ-SESYFVDAQP 537
             FG+ N ++N+R F+AG K N + Q   Q +ELAF   ++ ++ +  +   ESYFV  + 
Sbjct  523  GFGLYNGQDNKRIFVAG-KTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRD 581
Query  538  QQKEEGNKGRKGPLSSIL 555
            ++  +  +G   PLS  L
Sbjct  582  RRGFDERRGSNNPLSPFL 599

Sequence Alignment: 21. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 171.0 bits 723,  Expect = 2e-43
 Identities = 255/544 46%, Positives = 388/544 71%, Gaps = 52/544 9%
Query  9    EGQIPRPRPQHPERER-QQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKE 67
            + + P  + ++P  +R  Q  ++E D+ +Q          +      ++    ++ H   
Sbjct  24   QAKSPYRKTENPCAQRCLQSCQQEPDDLKQKACESRCTKLEYDPRCVYDTGATNQRHPPG 83
Query  68   EKHGGKGSEEEQDEREHPR--------PHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQ 119
            E+  G+   +  D+R +PR        P +P ++E E+ +W++ +E  +    ++  + +
Sbjct  84   ERTRGRQPGDYDDDRRQPRREEGGRWGPAEPREREREE-DWRQPREDWRRPSHQQPRKIR 142
Query  120  DEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQ 179
             E  E ++E   + GSE + E  R+   NPF+F S+RF T + NQ G +RVLQRF++RS+
Sbjct  143  PEGREGEQE-WGTPGSEVREETSRN---NPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSK 198
Query  180  QLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDAL 239
            Q+QNL+++RI++  ++PNTL+LP HADAD ++VI  G A +T+ N ++R S+NL  G AL
Sbjct  199  QFQNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHAL 258
Query  240  RVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEAS 299
            R+P+G   Y++N  +++NLR+  +++PVN PG+FE FF +S++ Q SYLQGFS+N LEA+
Sbjct  259  RIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAA 318
Query  300  YDTKFEEINKVLFGREEGQQQGEERLQ----------ESVIVEISKKQIRELSKHAKSSS 349
            ++ +F EI +VL+    G +Q EER Q          E VIV++SK++++EL+KHAKS S
Sbjct  319  FNAEFNEIRRVLLEENAGGEQ-EERGQRRRSTRSSDNEGVIVKVSKEHVQELTKHAKSVS 377
Query  350  RKTISSED--KPFNLRSRDPIYSNKLGKLFEITPEK-NPQLRDLDVFLSVVDMNEGALFL 406
            +K    ED   P NLR  +P  SN +G+LFE+ P+K NPQL+DLD+ L+ V++ EGAL L
Sbjct  378  KKGSEEEDITNPINLRDGEPDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALML 437
Query  407  PHFNSKAIVVLVINEGEANIELVGI-KEQQQR----QQQEEQPL---------EVRKYRA 452
            PHFNSKA+V++V+N+G  N+ELV + KEQQQR    Q+ EE+           EVR+Y A
Sbjct  438  PHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTA 497
Query  453  ELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELA 512
             L E D+F++PA +PV +NA+S+L+++ FGINAENN+R FLAG KDNVI QI  Q ++LA
Sbjct  498  RLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLA 557
Query  513  FPGSAKDIENLIKSQSESYFVDAQPQQK----------EEGNKGRKGPLSSILRAF 558
            FPGS + +E LIK+Q ES+FV A+PQ +          EE N+G KGPL SIL+AF
Sbjct  558  FPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQEEENQGGKGPLLSILKAF 613

Sequence Alignment: 22. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 167.8 bits 709,  Expect = 2e-42
 Identities = 257/526 48%, Positives = 378/526 71%, Gaps = 67/526 12%
Query  18   QHPERERQQHGEKEEDEGE-QPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSE 76
            Q P+  +Q+  E    + E  PR    PR    H    +++    E  R      G+   
Sbjct  48   QEPDDLKQKACESRCTKLEYDPRCVYDPRG---HTGTTNQRSPPGERTR------GRQPG 98
Query  77   EEQDEREHPR--------PHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKE 128
            +  D+R +PR        P  P ++E E+ +W++ +E  +    ++  + + E  E ++E
Sbjct  99   DYDDDRRQPRREEGGRWGPAGPREREREE-DWRQPREDWRRPSHQQPRKIRPEGREGEQE 157
Query  129  SQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR 188
               + GS  + E  R+   NPF+F S+RF T + NQ G +RVLQRF++RS+Q+QNL+++R
Sbjct  158  -WGTPGSHVREETSRN---NPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHR 213
Query  189  ILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYY 248
            I++  +KPNTL+LP HADAD ++VI  G A +T+ N ++R S+NL  G ALR+P+G   Y
Sbjct  214  IVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISY 273
Query  249  VVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEIN 308
            ++N  +++NLR+  +++PVN PG+FE FF +S++ Q SYLQGFS+N LEA+++ +F EI 
Sbjct  274  ILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIR 333
Query  309  KVLFGREEGQQQGEERLQ-----------ESVIVEISKKQIRELSKHAKSSSRKTISSED 357
            +VL+    G +Q EER Q           E VIV++SK+++ EL+KHAKS S+K    E 
Sbjct  334  RVLLEENAGGEQ-EERGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEG 392
Query  358  ---KPFNLRSRDPIYSNKLGKLFEITPEK-NPQLRDLDVFLSVVDMNEGALFLPHFNSKA 413
                P NLR  +P  SN +GKLFE+ P+K NPQL+DLD+ L+ V++ EGAL LPHFNSKA
Sbjct  393  DITNPINLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKA 452
Query  414  IVVLVINEGEANIELVGI-KEQQQRQQQEEQP----------LEVRKYRAELSEQDIFVI 462
            +V++V+N+G  N+ELV + KEQQQR ++EE+            EVR+Y A L E D+F++
Sbjct  453  MVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIM 512
Query  463  PAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIEN 522
            PA +PV +NA+S+L+++ FGINAENN+R FLAG KDNVI QI  Q ++LAFPGS + +E 
Sbjct  513  PAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEK 572
Query  523  LIKSQSESYFVDAQPQQK-----------------EEGNKGRKGPLSSILRAF 558
            LIK+Q ES+FV A+PQ +                 EE N+G KGPL SIL+AF
Sbjct  573  LIKNQKESHFVSARPQSQSQSPSSPEKESPEKEDQEEENQGGKGPLLSILKAF 625

Sequence Alignment: 23. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 164.4 bits 694,  Expect = 2e-41
 Identities = 170/521 32%, Positives = 316/521 60%, Gaps = 36/521 6%
Query  2    EEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQ--EEEH-EQK 58
            E++E C +      R +H     +  G+  E+E    R  P  R R+  +  E++H EQ+
Sbjct  46   EQKEACIQACKEYIRQKHQGEHGRGGGDILEEE-VWNRKSPIERLRECSRGCEQQHGEQR 104
Query  59   EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEED 118
            EE     +EE +  KG +++ +      P  P +K+ ++   Q +++   G  S E  E 
Sbjct  105  EECLRRCQEEYQREKGRQDDDN------PTDP-EKQYQQCRLQCRRQGEGGGFSREHCER 157
Query  119  QDEDEEQDKESQES------EGSESQREPRRH-KNKNPFHFNSKRFQTLFKNQYGHVRVL 171
            + E++ ++++ +E       EG E + E   + + + P+ F  + F T F+ Q+G +RVL
Sbjct  158  RREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVL 217
Query  172  QRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSY 231
            Q+F  RS+ L+ + +YR+  + ++P T+++P+H DA+ ++ +  G   ++LV  D R+S 
Sbjct  218  QKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESL 277
Query  232  NLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGF 291
            N++ GD L++ AGTT Y++N DN+E L +  L  PV+ PG FE FF +  +  +S+++ F
Sbjct  278  NIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSF 337
Query  292  SKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRK 351
            S  ILEA+++T+ + + ++ FG+   Q+QG       VIV+ S++Q+R +S+H +     
Sbjct  338  SDEILEAAFNTRRDRLQRI-FGQ---QRQG-------VIVKASEEQVRAMSRHEEGGIWP 386
Query  352  TISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNS 411
                     N+  + P +SN+ G+L E+   +  QLRDLD+ +S+ ++ +GA+  PH+NS
Sbjct  387  FGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNS 446
Query  412  KAIVVLVINEGEANIELVGIKEQQQR---QQQEEQPLEVRKYRAELSEQDIFVIPAGYPV 468
            KA  + ++ +GE   E+      + R   Q +       ++  + L+   + +IPAG+P 
Sbjct  447  KATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVVIIPAGHPF 506
Query  469  VVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKS 526
            V  A+S+ N+  + F +NA NN++  LAG + NV++Q+  + +ELAF   A+++E + +S
Sbjct  507  VAVASSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRS 565
Query  527  QSESYFVDAQPQQKEEG 543
            Q E +F    P+Q+++G
Sbjct  566  QQEEFFFKG-PRQQQQG 581

Sequence Alignment: 24. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 158.0 bits 666,  Expect = 1e-39
 Identities = 155/455 34%, Positives = 275/455 60%, Gaps = 28/455 6%
Query  79   QDEREHPRPHQ-PHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSES 137
            QD       HQ  HQ++ +++E +H Q        E++  ++ E    ++ S   EG E 
Sbjct  29   QDPELKQCKHQCRHQRQFDEQEKEHCQRSCDEYHIEKKARERAERRRSEEGSSREEGYEE 88
Query  138  QREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPN 197
            +      + +NP+ F  + F+T  +   G ++VL++F KRS+ L+ + ++R+  + + P 
Sbjct  89   EELGGEREEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQ 148
Query  198  TLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN 257
            T++ P H DA+ ++ +  G A +T V  + R+++N++ GD +R+PAGT  Y++N D +E 
Sbjct  149  TFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENEK 208
Query  258  LRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEG 317
            L ++ +  PV+ PG FE+F  S  +  +S+ + FS  +LEA+  T+ +++ K LFG+   
Sbjct  209  LYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEK-LFGK--- 264
Query  318  QQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDK--PFNLRSRDPIYSNKLGK 375
            Q QG       VI++ SK+QIR +SKH +++ R      D   PFNL  + P  SN++G+
Sbjct  265  QTQG-------VIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQFGR 317
Query  376  LFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV--GIKE 433
            LFE  P++  QL+DLD+ +S  ++ +G++  P++NS+A  + V+ EGE   E+    +  
Sbjct  318  LFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLSS 377
Query  434  QQQRQQQEEQPLEVRKYRAELSEQDI---------FVIPAGYPVVVNATSDLNF--FAFG 482
               R Q+E      R+ R+  S Q I         FV PAG+PV V A+ + N+  + F 
Sbjct  378  SGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFD 437
Query  483  INAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEE 542
            +NA+ N R  LAG K+N++++   + +ELAF   A+++E + ++Q + +F     +Q EE
Sbjct  438  VNAQGNIRFPLAG-KNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSRQPEE 496
Query  543  GNK 545
            G +
Sbjct  497  GGR 499

Sequence Alignment: 25. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 141.4 bits 593,  Expect = 1e-34
 Identities = 159/503 31%, Positives = 281/503 55%, Gaps = 31/503 6%
Query  18   QHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEE 77
            +H  + ++Q+ E+++++  +     +   +   QEEE    EE EW        G+G E 
Sbjct  10   KHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEEE----EEEEWGSGR----GRGDEF 61
Query  78   EQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSES 137
               E    R  Q  ++ E +   Q+KQ      + + ++E ++    +D+E +E EG E 
Sbjct  62   STHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKKERREHSYSRDEE-EEEEGDEE 120
Query  138  QREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPN 197
            Q E    +++NP+ F  + F T  K + G V VL +F KRS+ L+ L  YR+  + + P 
Sbjct  121  QEE----EDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQ 176
Query  198  TLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDEN 257
             +++P+H DAD +  +  G   +T +  + R+S N++ GD +R+ AGT +Y+VN D +E 
Sbjct  177  AFVVPNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEK 236
Query  258  LRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEG 317
            L ++ L  PVN PG +E F     +  +S+ + FS+ +LEA+  T  +++ K LF     
Sbjct  237  LYIVKLLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LF----- 290
Query  318  QQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKL 376
                 E+  E  IV+ SK+QIR +S+  +  S    + +    FNL  +DP  SN  G+L
Sbjct  291  -----EKQDEGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQL 345
Query  377  FEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQ 436
            FE   +  P L++LD+ +S V++ +G +  P +NS+A  + ++  GE  +E+        
Sbjct  346  FESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSS 405
Query  437  RQQ-QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNF--FAFGINAENNQRNFL 493
            +   QE+     +K  + +    +FV+PAG+P V  A+ + N+  + F +NAE N R  L
Sbjct  406  KNSGQEKSGPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTL 465
Query  494  AGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGR 547
            AG K N+I  +  + +ELAF    ++++ +   Q E +F    P+ ++   +GR
Sbjct  466  AGKK-NIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQG-PKWRQH-QQGR 516

Sequence Alignment: 26. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 119.5 bits 497,  Expect = 4e-28
 Identities = 146/431 33%, Positives = 264/431 61%, Gaps = 28/431 6%
Query  97   KHEWQHKQEKHQGKESEEEEEDQDED-----EEQDKESQESEGSESQREPRRHKNKNPFH 151
            K + + K+ KH+ ++  + +E Q  D     EE+ +E Q+ EG+ S+    + + +NP+ 
Sbjct  4    KEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPYV 63
Query  152  FNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLI 211
            F  + F++  K + G V+VL+ F KRS+ L  + ++R+  + + P+T++ P H DA+ ++
Sbjct  64   FQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVL 123
Query  212  VILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPG 271
             +  G A +T+V  + R+S+N++ GD +R+PAGT  Y++N D +E L ++ +  PV+ PG
Sbjct  124  FVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPG 183
Query  272  RFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIV 331
             FE+F+ +  +  +S+ + FS  +LEA+   + E++ KV FG    Q +G        IV
Sbjct  184  HFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKV-FGE---QSKGS-------IV 232
Query  332  EISKKQIRELSKHAKSSSRK-TISSEDK-PFNLRSRDPIYSNKLGKLFEITPEKNPQLRD 389
            + S+++IR LS+H +   R      E   P NL  + P  SN++G+L+E  P+ + QL+D
Sbjct  233  KASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQD 292
Query  390  LDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRK 449
            LD+ +S  ++ +G++  P++NS+A  + V+ EGE   E+            +       K
Sbjct  293  LDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQ-------K 345
Query  450  YRAELSEQDIFVIPAGYPVVVNAT--SDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQ 507
              A L    +FV PAG+PV V A+  ++L  + F +NA  N R  LAG K N++++    
Sbjct  346  ISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG-KGNIVNEFERD 404
Query  508  VQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKG 546
             +ELAF   ++++E + K+Q +++F     +Q+EEG +G
Sbjct  405  AKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443

Sequence Alignment: 27. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 118.4 bits 492,  Expect = 1e-27
 Identities = 123/399 30%, Positives = 230/399 57%, Gaps = 25/399 6%
Query  131  ESEGSESQREPRRH-KNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRI 189
            E  G   +R  R   + +NP+ F+S RF+    ++ G +R L  F + S+ L+ +  YR+
Sbjct  47   EEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRV 106
Query  190  LEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYV 249
                 KPNT++LPH+ DA +++ +  G   +  V  ++     L+ GD + VP+G T+Y+
Sbjct  107  TCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYL 166
Query  250  VNPDNDENLRMITLA-IPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEIN 308
            VN D+  +LR+ +L        G +E F+++  +  ++    FS ++LEA+++T  +++ 
Sbjct  167  VNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLE 226
Query  309  KVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSED-KPFNLRSRDP 367
             + FG    +++G       VI   +++QIRE+ +    S+  T +SE  KPFNLR++ P
Sbjct  227  HI-FG---AHRRG-------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKP 275
Query  368  IYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIE 427
             + N  G++    P+ NP L  +DV +    +N G +  P  N+KA  + ++ EGE  IE
Sbjct  276  DFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIE 335
Query  428  LVGIKEQQQR-----QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFA 480
            +      Q+      +++  Q +   + RA L    ++V+PAG+P+   A+++  L  + 
Sbjct  336  MACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILW 395
Query  481  FGINAENNQRNFLAGSKDNVISQIPSQVQELAF--PGSAKDIENLIKSQSESYFVDAQPQ 538
            F IN   N+R FLAG K+NV+  +  +V+ L+F  P   ++IE ++++Q +   +    +
Sbjct  396  FDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQR 453
Query  539  QKEE 542
            Q+ +
Sbjct  454  QRRD 457

Sequence Alignment: 28. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 107.9 bits 446,  Expect = 2e-24
 Identities = 155/490 31%, Positives = 275/490 56%, Gaps = 50/490 10%
Query  18   QHPERERQQHGEKEEDE--GEQPRPFPFPRPRQ-PHQEEEHEQK----EEHEWHRKEEKH 70
            +H  + ++Q+ E+++++   E  + +   + R+  H+EEE E      +E   H   EKH
Sbjct  34   KHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKH 93
Query  71   GGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQ 130
                    Q  R+  R    +QK+  +   Q + +K +G+ + + E+D+DEDE++ +E  
Sbjct  94   LS------QCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEED 147
Query  131  ESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRIL 190
            E                NP+ F  + F T  K + G V +L +F ++S+ L+ L  YR+ 
Sbjct  148  E----------------NPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLA 191
Query  191  EFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVV 250
             + + P  +++P H DAD +  +  G   +T +  + R+S N++ GD + + +GT +Y+ 
Sbjct  192  VLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIA 251
Query  251  NPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKV 310
            N D +E L ++ +  PVN PG FE F     +  +S+ + FS  ILEA+  T  + + K 
Sbjct  252  NNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK- 310
Query  311  LFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDK-PFNLRSRDPIY 369
            LF   E Q QG        I++ SK+Q+R +S+  +       + E    F L  +DP  
Sbjct  311  LF---EKQDQG-------TIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQ 360
Query  370  SNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV 429
            SNK G+LFE      P L  LD+ +S  ++ +G + +P +NS+A  + ++  GE  +E  
Sbjct  361  SNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE-- 418
Query  430  GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYP--VVVNATSDLNFFAFGINAEN 487
             I   +    +  +P   +K RA + +  +F++PAG+P   V +   +L    F +NAE 
Sbjct  419  -IACPHLSSSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEG 476
Query  488  NQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGR 547
            N R  LAG K N+I  +  + +ELAF    ++++ +   Q E +F    P+ ++E  +GR
Sbjct  477  NIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKE-KEGR 533

Sequence Alignment: 29. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 107.9 bits 446,  Expect = 2e-24
 Identities = 156/490 31%, Positives = 275/490 56%, Gaps = 50/490 10%
Query  18   QHPERERQQHGEKEEDE--GEQPRPFPFPRPRQ-PHQEEEHEQK----EEHEWHRKEEKH 70
            +H  + ++Q+ E+++++   E  + +   + R+  H+EEE E      +E   H   EKH
Sbjct  36   KHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKH 95
Query  71   GGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQ 130
                    Q  R+  R    +QK+  +   Q + +K +G+ + + E+D+DEDE++ +E  
Sbjct  96   LS------QCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEED 149
Query  131  ESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRIL 190
            E                NP+ F  + F T  K + G V +L +F ++S+ L+ L  YR+ 
Sbjct  150  E----------------NPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLA 193
Query  191  EFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVV 250
             + + P  +++P H DAD +  +  G   +T +  + R+S N++ GD + + +GT +Y+ 
Sbjct  194  VLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIA 253
Query  251  NPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKV 310
            N D +E L ++ +  PVN PG FE F     +  +S+ + FS  ILEA+  T  + + K 
Sbjct  254  NNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK- 312
Query  311  LFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDK-PFNLRSRDPIY 369
            LF   E Q QG        I++ SK+QIR +S+  +       + E    F L  +DP  
Sbjct  313  LF---EKQDQG-------TIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQ 362
Query  370  SNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV 429
            SNK G+LFE      P L  LD+ +S  ++ +G + +P +NS+A  + ++  GE  +E  
Sbjct  363  SNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE-- 420
Query  430  GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYP--VVVNATSDLNFFAFGINAEN 487
             I   +    +  +P   +K RA + +  +F++PAG+P   V +   +L    F +NAE 
Sbjct  421  -IACPHLSSSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEG 478
Query  488  NQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGR 547
            N R  LAG K N+I  +  + +ELAF    ++++ +   Q E +F    P+ ++E  +GR
Sbjct  479  NIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKE-KEGR 535

Sequence Alignment: 30. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 59.3 bits 233,  Expect = 6e-10
 Identities = 108/395 27%, Positives = 201/395 50%, Gaps = 66/395 16%
Query  133  EGSESQRE---PRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRI 189
            EG E + E   PR  +++  F +  +R + ++K   G VR++  +  R     N     I
Sbjct  36   EGREKRVEEKAPRSPEDRGLFIL--RRSKEVLKTDAGEVRLMMGYRYRG----NHSPMHI 89
Query  190  LEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYV 249
                 +PNTL +P++ DA  ++ +  G A +  +  +      L+SG    +PAG+++Y+
Sbjct  90   GFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYI 149
Query  250  VNPDNDENLRMI----TLAIPVNKPGRF-ESFFLSSTQAQQSYLQGFSKNILEASYDTKF 304
            VN D  E L +I    TL   +   G + +SF++      +S L GF  + L A+++   
Sbjct  150  VNSDKSERLHIICSIDTLE-SMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSS 208
Query  305  EEINKVLFGREEGQ------QQGEERLQESVIVEISKKQIRE------------------ 340
            +++  +L  +  G       +  E+R   S I+++ ++ ++E                  
Sbjct  209  DQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDV 268
Query  341  ----------LSKHAKSSSRK-TISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRD 389
                      L K      RK  ++     +NL   +P Y N  G    I       L+ 
Sbjct  269  WTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKH 328
Query  390  LDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRK 449
             ++ + +V++  GA++ PH N  A    +I  G   I++V              P     
Sbjct  329  SNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVF-------------PNGTAA 375
Query  450  YRAELSEQDIFVIPAGYPV--VVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQ 507
              A++SE D+F IP  +P   + +  + L FF F  +A  N+  FL G K +++  +   
Sbjct  376  MNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVG-KSSLLHSMRGP 434
Query  508  VQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRK 548
                AF  S + +E ++K+Q E+  +   P+++ E   G+K
Sbjct  435  ELAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKK 475

Sequence Alignment: 31. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 47.7 bits 182,  Expect = 2e-06
 Identities = 78/271 28%, Positives = 134/271 49%, Gaps = 65/271 23%
Query  6    ECEEGQIPRPRPQHPER-ERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKE----- 59
            E E+ Q+ R   Q   R ER +  E+EE EGE+      P  R  HQEEE + +E     
Sbjct  191  EEEQRQLRRLAQQMQGRSERGEESEEEEGEGEEEEEEDNPSRRSRHQEEEEQGRESSSCN 250
Query  60   -----------------EHEWHRKEEK-HGGKGSE-EEQDEREHPRPHQPHQKEEEKHEW 100
                             +H+  RK ++  G +G+    +D  +   P  P  +EEE+ E 
Sbjct  251  NLLCAFDRNFLAQAFNVDHDIIRKIQRVRGNRGTIIRVRDRLQVVTP--PRMEEEEREER 308
Query  101  QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTL 160
            Q++Q   + +        QD   E+   S   +  E+  +P R    NP           
Sbjct  309  QQEQRYRHTRGG-----SQDNGLEETFCSMRIK--ENLADPERADIFNP----------- 350
Query  161  FKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPH-HADADYLIVILNGTAI 219
               Q G +  L RFN    Q   L   R + +N      L+P+ + +A  ++ +L G A 
Sbjct  351  ---QAGRISTLNRFNLPILQRLELSAERGVLYNRAG---LIPQWNVNAHKILYMLRGCAR 404
Query  220  LTLVNNDDRDSY--NLQSGDALRVPAGTTYYV-VNPDNDENLRMITLAIPVNKPGRFESF 276
            + +VN++    +  N++ G  L VP    +      +  E +   T +   N P      
Sbjct  405  VQVVNHNGDAVFDDNVEQGQLLTVPQNFAFMKQAGNEGAEWISFFTNSEATNTP------ 458
Query  277  FLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLF 312
                     S+++ + + ++ ASY    E+  ++ F
Sbjct  459  ----MAGSVSFMRALPEEVVAASYQVSREDARRIKF 490

Sequence Alignment: 32. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 43.6 bits 164,  Expect = 4e-05
 Identities = 77/271 28%, Positives = 145/271 53%, Gaps = 63/271 23%
Query  20   PERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQ 79
            P+ + QQ  +++EDE ++    P   PR+P     H ++E+ E             +E++
Sbjct  274  PKWQEQQDEDEDEDEDDEDEQIPSHPPRRP----SHGKREQDE-------------DEDE 316
Query  80   DEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQR 139
            DE + PRP +P Q + E+               ++++ED+DEDE+Q ++S+E    ++Q 
Sbjct  317  DE-DKPRPSRPSQGKREQ--------------DQDQDEDEDEDEDQPRKSREWRSKKTQ- 360
Query  140  EPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQ-QLQNLRDYRILEFNSKPNT 198
             PRR + + P     +    + +N    +++ +   + S+  + N +  RI  +NS    
Sbjct  361  -PRRPRQEEPRERGCETRNGVEEN-ICTLKLHENIARPSRADFYNPKAGRISTLNSLTLP 418
Query  199  LLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGT-TYYVVNPDND-- 255
             L   +  A Y+++  NG  I +         +NL +   + V  G     VVN   +  
Sbjct  419  ALRQFQLSAQYVVLYKNG--IYS-------PHWNLNANSVIYVTRGQGKVRVVNCQGNAV 469
Query  256  ---ENLRMITLAIPVN-----KPGR--FESF-FLSSTQAQQSYLQ----GFSKNILEASY 300
               E  R   L +P N     + G   FE   F +   A  SYL+         +L  SY
Sbjct  470  FDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLKDVFRAIPSEVLAHSY 529
Query  301  DTKFEEINKVLFGREEGQQQGEERLQESVIVEIS 334
            + +  +++++ +    G     E  Q S  V+++
Sbjct  530  NLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA 563

Sequence Alignment: 33. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 42.9 bits 161,  Expect = 5e-05
 Identities = 51/208 24%, Positives = 104/208 50%, Gaps = 22/208 10%
Query  314  REEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNL-RSRDP-IYSN 371
            +EE     EE+ Q    VE  K   R+ SK +++   +TI +     N+ ++  P IY+ 
Sbjct  271  QEEDDDDEEEQPQ---CVETDKGCQRQ-SKRSRNGIDETICTMRLRQNIGQNSSPDIYNP 326
Query  372  KLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGI 431
            + G +   T    P L  L +      + + A+F+PH+   A  ++    G A +++V  
Sbjct  327  QAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNC 386
Query  432  KEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD-LNFFAFGINAENNQR 490
              +             R +  EL E  ++++P  + V   + SD + + +F  N   +  
Sbjct  387  NGE-------------RVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIG 433
Query  491  NFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQK 540
            N LAG+ +++++ +P +V +  F   ++    +  +   S++V  Q  Q+
Sbjct  434  N-LAGA-NSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQR 481

Sequence Alignment: 34. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 42.9 bits 161,  Expect = 5e-05
 Identities = 51/208 24%, Positives = 104/208 50%, Gaps = 22/208 10%
Query  314  REEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNL-RSRDP-IYSN 371
            +EE     EE+ Q    VE  K   R+ SK +++   +TI +     N+ ++  P IY+ 
Sbjct  271  QEEDDDDEEEQPQ---CVETDKGCQRQ-SKRSRNGIDETICTMRLRQNIGQNSSPDIYNP 326
Query  372  KLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGI 431
            + G +   T    P L  L +      + + A+F+PH+   A  ++    G A +++V  
Sbjct  327  QAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNC 386
Query  432  KEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD-LNFFAFGINAENNQR 490
              +             R +  EL E  ++++P  + V   + SD + + +F  N   +  
Sbjct  387  NGE-------------RVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIG 433
Query  491  NFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQK 540
            N LAG+ +++++ +P +V +  F   ++    +  +   S++V  Q  Q+
Sbjct  434  N-LAGA-NSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQR 481

Sequence Alignment: 35. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 42.9 bits 161,  Expect = 5e-05
 Identities = 84/292 28%, Positives = 153/292 52%, Gaps = 84/292 28%
Query  231  YNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNK--------PGRF------ESF 276
            YN++ GD + VP G  +++ N + D  +  +++ I  N         P RF      E  
Sbjct  134  YNFREGDLIAVPTGVAWWMYN-NEDTPVVAVSI-IDTNSLENQLDQMPRRFYLAGNQEQE 191
Query  277  FLSSTQAQQ------------------SYLQGFSKNILEASYDTKFEEINKVLFGREEGQ 318
            FL   Q Q                   S L GF+   LE ++    ++I K L G  EG+
Sbjct  192  FLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGE 250
Query  319  QQG-------------------EERLQESVIVEISKK-QIRELSKH------AKSSSRK- 351
             +G                   ++R QE    E  +K Q +   KH      ++S SR+ 
Sbjct  251  DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRN 310
Query  352  ----TISSEDKPFNL-RSRDP-IYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALF 405
                TI +     N+ ++  P IY+ + G +   T    P L  L +      + + A+F
Sbjct  311  GIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMF 370
Query  406  LPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAG 465
            +PH+N  A  ++    G A I++V    +             R +  EL E  ++++P  
Sbjct  371  VPHYNLNANSIIYALNGRALIQVVNCNGE-------------RVFDGELQEGRVLIVPQN 417
Query  466  YPVVVNATSD-LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLI 524
            + V   + SD + + +F  N +      LAG+ +++++ +P +V +  F   ++    + 
Sbjct  418  FVVAARSQSDNFEYVSFKTN-DTPMIGTLAGA-NSLLNALPEEVIQHTFNLKSQQARQIK 475
Query  525  KSQSESYFVDAQPQQK 540
             +    ++V  Q  QK
Sbjct  476  NNNPFKFLVPPQESQK 491

Sequence Alignment: 36. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 42.9 bits 161,  Expect = 5e-05
 Identities = 84/292 28%, Positives = 153/292 52%, Gaps = 84/292 28%
Query  231  YNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNK--------PGRF------ESF 276
            YN++ GD + VP G  +++ N + D  +  +++ I  N         P RF      E  
Sbjct  134  YNFREGDLIAVPTGVAWWMYN-NEDTPVVAVSI-IDTNSLENQLDQMPRRFYLAGNQEQE 191
Query  277  FLSSTQAQQ------------------SYLQGFSKNILEASYDTKFEEINKVLFGREEGQ 318
            FL   Q Q                   S L GF+   LE ++    ++I K L G  EG+
Sbjct  192  FLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGE 250
Query  319  QQG-------------------EERLQESVIVEISKK-QIRELSKH------AKSSSRK- 351
             +G                   ++R QE    E  +K Q +   KH      ++S SR+ 
Sbjct  251  DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRN 310
Query  352  ----TISSEDKPFNL-RSRDP-IYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALF 405
                TI +     N+ ++  P IY+ + G +   T    P L  L +      + + A+F
Sbjct  311  GIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMF 370
Query  406  LPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAG 465
            +PH+N  A  ++    G A I++V    +             R +  EL E  ++++P  
Sbjct  371  VPHYNLNANSIIYALNGRALIQVVNCNGE-------------RVFDGELQEGRVLIVPQN 417
Query  466  YPVVVNATSD-LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLI 524
            + V   + SD + + +F  N +      LAG+ +++++ +P +V +  F   ++    + 
Sbjct  418  FVVAARSQSDNFEYVSFKTN-DTPMIGTLAGA-NSLLNALPEEVIQHTFNLKSQQARQIK 475
Query  525  KSQSESYFVDAQPQQK 540
             +    ++V  Q  QK
Sbjct  476  NNNPFKFLVPPQESQK 491

Sequence Alignment: 37. Allergen Name: Tri a gliadin Sequence ID: CAA26383

 Score = 40.8 bits 151,  Expect = 0.0001
 Identities = 25/102 24%, Positives = 59/102 57%, Gaps = 5/102 4%
Query  13   PRPRPQHPERERQQH-GEKEEDEGEQPRPFPFPRP-RQPH---QEEEHEQKEEHEWHRKE 67
            P+P+ Q P  ++QQ  G++++   +QP P P P P +QP+   Q   + Q    +    +
Sbjct  36   PQPQGQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQ 95
Query  68   EKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEE 114
                       Q + ++P+P+QP  +++ +++ Q++Q+++Q ++ ++
Sbjct  96   PPPFSPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQ 142

Sequence Alignment: 38. Allergen Name: Tri a gliadin Sequence ID: AAA34290

 Score = 40.6 bits 150,  Expect = 0.0002
 Identities = 25/102 24%, Positives = 59/102 57%, Gaps = 5/102 4%
Query  13   PRPRPQHPERERQQH-GEKEEDEGEQPRPFPFPRP-RQPH---QEEEHEQKEEHEWHRKE 67
            P+P+ Q P  ++QQ  G++++   +QP P P P P +QP+   Q   + Q    +    +
Sbjct  36   PQPQRQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQ 95
Query  68   EKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEE 114
                       Q + ++P+P+QP  +++ +++ Q++Q+++Q ++ ++
Sbjct  96   PPPFSPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQ 142

Sequence Alignment: 39. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 37.0 bits 135,  Expect = 0.004
 Identities = 94/403 23%, Positives = 199/403 49%, Gaps = 69/403 17%
Query  101  QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTL 160
            + +Q  +QG++ E+E+E Q   ++Q  E    +G + Q++ R+ + +   +    R Q  
Sbjct  114  ESQQSSQQGRQQEQEQERQ---QQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ 170
Query  161  FKNQYGHVRVLQRFNK--RSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTA 218
             + Q G  +  Q+F +  R Q+ + +R+  ++     P  +    + D D  +V +N   
Sbjct  171  QQGQQGRPQQQQQFRQFDRHQKTRRIREGDVVAI---PAGVAYWSYNDGDQELVAVNLFH 227
Query  219  ILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVN---KPGRFES 275
            + +  N  D++   +             Y   NP+N+ N +  +         +PG+ + 
Sbjct  228  VSSDHNQLDQNPRKF-------------YLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQ 274
Query  276  FFLSSTQAQQ-----SYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQ-----G---- 321
             F    Q +Q     + + GF+  +L  + +   EE  + L G+ + + Q     G    
Sbjct  275  PFGRPRQQEQQGSGNNVFSGFNTQLLAQALNVN-EETARNLQGQNDNRNQIIRVRGNLDF 333
Query  322  ------------EERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIY 369
                        EER QE +  E  ++Q  +L  +    +  ++  ++   N    D I+
Sbjct  334  VQPPRGRQEREHEERQQEQLQQE-RQQQGGQLMANGLEETFCSLRLKENIGNPERAD-IF 391
Query  370  SNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV 429
            S + G++  +     P LR L +           ++ PH+N  A  V+ +  G A +++V
Sbjct  392  SPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVV 451
Query  430  GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD-LNFFAFGINAENN 488
                     +  +  L+      E+ +  +F++P  + V+  A +  + +FAF    EN 
Sbjct  452  N--------ENGDAILD-----QEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFK-TEENA 497
Query  489  QRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQK 540
              N LAG + + +  +P +V   A+  S +    L  ++ E+  + +  Q++
Sbjct  498  FINTLAG-RTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRR 548

Sequence Alignment: 40. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 36.8 bits 134,  Expect = 0.004
 Identities = 94/403 23%, Positives = 199/403 49%, Gaps = 69/403 17%
Query  101  QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTL 160
            + +Q  +QG++ E+E+E Q   ++Q  E    +G + Q++ R+ + +   +    R Q  
Sbjct  94   ESQQSSQQGRQQEQEQERQ---QQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ 150
Query  161  FKNQYGHVRVLQRFNK--RSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTA 218
             + Q G  +  Q+F +  R Q+ + +R+  ++     P  +    + D D  +V +N   
Sbjct  151  QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAI---PAGVAYWSYNDGDQELVAVNLFH 207
Query  219  ILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVN---KPGRFES 275
            + +  N  D++   +             Y   NP+N+ N +  +         +PG+ + 
Sbjct  208  VSSDHNQLDQNPRKF-------------YLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQ 254
Query  276  FFLSSTQAQQ-----SYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQ-----G---- 321
             F    Q +Q     + + GF+  +L  + +   EE  + L G+ + + Q     G    
Sbjct  255  PFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVN-EETARNLQGQNDNRNQIIQVRGNLDF 313
Query  322  ------------EERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIY 369
                        EER QE +  E  ++Q  +L  +    +  ++  ++   N    D I+
Sbjct  314  VQPPRGRQEREHEERQQEQLQQE-RQQQGEQLMANGLEETFCSLRLKENIGNPERAD-IF 371
Query  370  SNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV 429
            S + G++  +     P LR L +           ++ PH+N  A  V+ +  G A +++V
Sbjct  372  SPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVV 431
Query  430  GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD-LNFFAFGINAENN 488
                     +  +  L+      E+ +  +F++P  + V+  A +  + +FAF    EN 
Sbjct  432  N--------ENGDAILD-----QEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFK-TEENA 477
Query  489  QRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQK 540
              N LAG + + +  +P +V   A+  S +    L  ++ E+  + +  Q++
Sbjct  478  FINTLAG-RTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRR 528

Sequence Alignment: 41. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 36.6 bits 133,  Expect = 0.004
 Identities = 105/385 27%, Positives = 196/385 50%, Gaps = 60/385 15%
Query  153  NSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIV 212
            NS R   +FK   G +RVL+    R       R   I   + +P +L++P++ D++ +I 
Sbjct  41   NSTR---VFKTDAGEMRVLKSHGGRIF----YRHMHIGFISMEPKSLFVPQYLDSNLIIF 93
Query  213  ILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPG- 271
            I  G A L ++ +D+     L++GD   +P+G+ +Y+VN    + L +I    P    G 
Sbjct  94   IRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLGL 153
Query  272  -RFESFFLSSTQAQQSYLQGFSKNILEASYD---TKFEEI-NKVLFG------------- 313
              F+SF++      +S L GF   ILE +++   T  EEI +K L G             
Sbjct  154  ETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFVDDSHAPSL 213
Query  314  --------REEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKT---ISSED---KP 359
                    +++ +QQ ++ +Q+    E  K+  R   K  ++   K    I ++D    P
Sbjct  214  WTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSP 273
Query  360  --FNLRS-RDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVV 416
              +NL   +   + N  G    +   + P L + D+ + +V ++ G+++ PH N  +   
Sbjct  274  ASYNLYDDKKADFKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEY 333
Query  417  LVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD- 475
             ++  G   +  +G             P   R  + ++ + D+FV+P  +P    A+ D 
Sbjct  334  TIVLSGYGELH-IGY------------PNGSRAMKTKIKQGDVFVVPRYFPFCQVASRDG 380
Query  476  -LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFV- 533
             L FF F  +A  N+  FLAG+   + + +  ++   AF  S   +   + +Q E+  + 
Sbjct  381  PLEFFGFSTSARKNKPQFLAGAASLLRTLMGPELSA-AFGVSEDTLRRAVDAQHEAVILP 439
Query  534  DAQPQQKEEGNKGRKGPLSSILRAF 558
             A     E   K +     + +R+F
Sbjct  440  SAWAAPPENAGKLKMEEEPNAIRSF 464

Sequence Alignment: 42. Allergen Name: Tri a gliadin Sequence ID: AAA34279

 Score = 35.8 bits 129,  Expect = 0.005
 Identities = 23/112 20%, Positives = 62/112 55%, Gaps = 2/112 1%
Query  14   RPRPQHPERERQQH-GEKEEDEGEQPRPFPFPRP-RQPHQEEEHEQKEEHEWHRKEEKHG 71
            +P+ Q P  ++QQ  G++++   +QP P P P P +QP+ + +   + +    +    + 
Sbjct  34   QPQEQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFLPQLPYPQP 93
Query  72   GKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQ 125
                 ++   ++ P+  QP+Q   +++  Q++Q+++Q ++ ++++  Q   ++Q
Sbjct  94   QSFPPQQPYPQQRPKYLQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQ 147

Sequence Alignment: 43. Allergen Name: Tri a gliadin Sequence ID: AAA34278

 Score = 35.3 bits 127,  Expect = 0.007
 Identities = 23/98 23%, Positives = 56/98 57%, Gaps = 5/98 5%
Query  14   RPRPQHPERERQQH-GEKEEDEGEQPRPFPFPRP-RQPH---QEEEHEQKEEHEWHRKEE 68
            +P+ Q P  ++QQ  G++++   +QP P P P P +QP+   Q   + Q    +    + 
Sbjct  37   QPQEQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQP 96
Query  69   KHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKE 111
            +         Q + ++ +P+QP  +++ +++ Q++Q+++Q ++
Sbjct  97   QSFPPQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQ 139

Sequence Alignment: 44. Allergen Name: Tri a gliadin Sequence ID: AAA34288

 Score = 34.5 bits 123,  Expect = 0.009
 Identities = 36/161 22%, Positives = 86/161 53%, Gaps = 19/161 11%
Query  11   QIPRPRPQHP--ERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEE 68
            Q P P+P++P  ++ +Q   + ++    QP+   FP+P+QP+Q+  + Q+   +  ++  
Sbjct  34   QQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQ-QFPQPQQPQQQFLQPQQPFPQQPQQ-- 90
Query  69   KHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKE 128
                     +Q ++  P+ +QP+Q   + ++ Q++  + Q +  + ++  Q   ++Q   
Sbjct  91   ------PYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPF 144
Query  129  SQESEGSESQREPRRH---KNKNPFHFNSKRFQTLFKNQYGHV---RVLQRFNKRSQQLQ 182
             Q S   + Q  P ++   +   P  + S  +  ++     +V   +  Q++ +  QQLQ
Sbjct  145  IQPSL--QQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQ 202

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.