The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDE
QSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA
Sequence Info Allergen Name Length Opt Bits Score E Value
CAI78451 Mala s 13.0101 105 710 213.3 1.1e-57
Q9UW02 Cop c 2 106 408 124.8 4.8e-31
AJ937745 Asp f 29.0101 110 373 114.6 6.1e-28
CBW45298 Plo i 2.0101 106 301 93.5 1.3e-21
AAL79931 Fus c 2 121 289 90.0 1.7e-20
Q9LDX4 Tri a 25.0101 125 276 86.1 2.5e-19
Q4W1F7 Zea m 25.0101 128 264 82.6 2.9e-18
AJ937744 Asp f 28.0101 108 257 80.6 1e-17
CAA58999 Alt a 4 433 143 47.1 5e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mala s 13.0101 Sequence ID: CAI78451

 Score = 213.3 bits 710,  Expect = 1e-57
 Identities = 105/105 100%, Positives = 105/105 100%, Gaps = 0/105 0%
Query  1    VQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDE 60
            VQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDE
Sbjct  1    VQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDE 60
Query  61   QSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 105
            QSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA
Sbjct  61   QSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 105

Sequence Alignment: 2. Allergen Name: Cop c 2 Sequence ID: Q9UW02

 Score = 124.8 bits 408,  Expect = 5e-31
 Identities = 54/105 51%, Positives = 78/105 74%, Gaps = 0/105 0%
Query  1    VQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDE 60
            VQVIS+ D+F ++T   K+++IDFWATWCGPC++I P+FEK S+    + + F KVDVD 
Sbjct  2    VQVISNLDEFNKLTNSGKIIIIDFWATWCGPCRVISPIFEKFSEKYGANNIVFAKVDVDT 61
Query  61   QSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 105
             S I++E  IRAMPTF  +K+GQKID +VGA+P+ L++ + +  A
Sbjct  62   ASDISEEAKIRAMPTFQVYKDGQKIDELVGANPTALESLVQKSLA 106

Sequence Alignment: 3. Allergen Name: Asp f 29.0101 Sequence ID: AJ937745

 Score = 114.6 bits 373,  Expect = 6e-28
 Identities = 54/105 51%, Positives = 75/105 71%, Gaps = 1/105 0%
Query  1    VQVISSYDQFKQ-VTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVD 59
            V+ I+    FK+ V  G   V++D  ATWCGPCK I PVF+++S +       FY++DVD
Sbjct  5    VEKITDAKVFKEKVQEGSGPVIVDCSATWCGPCKAISPVFQRLSTSEEFKNAKFYEIDVD 64
Query  60   EQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 105
            E S++A E+G+RAMPTF+FFK+GQK++ VVGA+P  L+AAI  H A
Sbjct  65   ELSEVAAELGVRAMPTFMFFKDGQKVNEVVGANPPALEAAIKAHVA 110

Sequence Alignment: 4. Allergen Name: Plo i 2.0101 Sequence ID: CBW45298

 Score = 93.5 bits 301,  Expect = 1e-21
 Identities = 46/86 53%, Positives = 60/86 69%, Gaps = 1/86 1%
Query  16   GDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDEQSQIAQEVGIRAMPT 75
            GDK+VVIDF ATWCGPCK+IGP +++I+   A D +   KVDVDE   IA E  I  MPT
Sbjct  19   GDKLVVIDFMATWCGPCKIIGPKLDEIAAEMA-DSIVVVKVDVDECEDIATEYSINTMPT 77
Query  76   FVFFKNGQKIDTVVGADPSKLQAAITQ 102
            FVF KNG+ ++   GA+  KL++ I +
Sbjct  78   FVFVKNGKPVEQFSGANVEKLRSTILK 104

Sequence Alignment: 5. Allergen Name: Fus c 2 Sequence ID: AAL79931

 Score = 90.0 bits 289,  Expect = 2e-20
 Identities = 45/99 45%, Positives = 66/99 66%, Gaps = 6/99 6%
Query  1    VQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPA-GDKVGFYKVDVD 59
            V+ I+S D+++++      VV+DF+A WC PCK I PV+E++S   +  D + F KV+VD
Sbjct  2    VHHITSNDELQKLLSSTTYVVVDFFADWCPPCKAIAPVYEQLSTKHSVPDVLAFAKVNVD 61
Query  60   EQSQIAQEVGIRAMPTFVFFKNGQKIDT-----VVGADPSKLQAA 99
                 AQ+ GI AMPTF+FFK G+++       + GADP  L AA
Sbjct  62   HVQDAAQQYGITAMPTFMFFKEGKQVAVNGQAVIKGADPRTLGAA 106

Sequence Alignment: 6. Allergen Name: Tri a 25.0101 Sequence ID: Q9LDX4

 Score = 86.1 bits 276,  Expect = 2e-19
 Identities = 42/94 44%, Positives = 59/94 62%, Gaps = 4/94 4%
Query  9    QFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDT-PAGDKVGFYKVDVDEQSQIAQE 67
            Q ++     K+VVIDF A+WCGPC+++ P+F  ++   PA     F KVDVDE   IA++
Sbjct  30   QIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPA---AVFLKVDVDELKSIAEQ 86
Query  68   VGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 105
              + AMPTF+F K G   D VVGA   +L   +  H+A
Sbjct  87   FSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLHAA 124

Sequence Alignment: 7. Allergen Name: Zea m 25.0101 Sequence ID: Q4W1F7

 Score = 82.6 bits 264,  Expect = 3e-18
 Identities = 40/95 42%, Positives = 55/95 57%, Gaps = 2/95 2%
Query  9    QFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDEQSQIAQEV 68
            Q ++     K+VVIDF ATWC PC+ + P+F  ++       V F KVDVDE   IA++ 
Sbjct  33   QIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKK--SPNVVFLKVDVDEMKTIAEQF 90
Query  69   GIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 105
             + AMPTF+F + G   D VVGA   +L   +  H A
Sbjct  91   SVEAMPTFLFMREGDVKDRVVGAAKEELARKLELHMA 127

Sequence Alignment: 8. Allergen Name: Asp f 28.0101 Sequence ID: AJ937744

 Score = 80.6 bits 257,  Expect = 1e-17
 Identities = 42/93 45%, Positives = 64/93 68%, Gaps = 4/93 4%
Query  10   FKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDEQSQIAQEVG 69
            +K +T    VVV DF+ATWCGPC+ + P   ++S+  +   V F +VDVD+   +A+E+ 
Sbjct  15   YKALTSSGPVVV-DFFATWCGPCRAVAPKVGELSEKYSN--VRFIQVDVDKVRSVAHEMN 71
Query  70   IRAMPTFVFFKNGQKIDT-VVGADPSKLQAAITQHSA 105
            IRAMPTFV++K+GQ ++  VVG +  +L+  I   SA
Sbjct  72   IRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIKSISA 108

Sequence Alignment: 9. Allergen Name: Alt a 4 Sequence ID: CAA58999

 Score = 47.1 bits 143,  Expect = 5e-07
 Identities = 32/104 30%, Positives = 55/104 52%, Gaps = 10/104 9%
Query  1    VQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDK----VGFYKV 56
            V V+ +++    V   DK V+++F+A WCG CK + P +E++    A D+    V   KV
Sbjct  235  VTVVVAHNYKDVVIDNDKDVLVEFYAPWCGHCKALAPKYEELGQLYASDELSKLVTIAKV 294
Query  57   DVDEQSQIAQEV-GIRAMPTFVFFKNGQKIDTVV----GADPSKLQAAITQHSA 105
            D    + +  E+ G      F + +   +  T+V    G+ P   +  +TQ SA
Sbjct  295  DAT-LNDVPDEIQGFLPSSLFPLARRMPQSTTLVPHCRGSRPVHRRERLTQASA 347

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.