The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR
IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRPICLPI
EESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAYSDVSDTVICAG
YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTSYLDSFILPA
LKK
Sequence Info Allergen Name Length Opt Bits Score E Value
Q7M4I3 Bom p 4.0101 243 1691 392.2 8.5e-111
AAN02286 Api m 7 405 445 108.0 5e-25
AAP37412 Pol d 4.0101 277 396 96.9 7.3e-22
P09582 Can f 5.0101 260 372 91.5 3e-20
P49275 Der f 3 259 367 90.3 6.6e-20
P39675 Der p 3 261 365 89.9 9.1e-20
ABZ81991 Tyr p 3.0101 285 361 88.9 1.9e-19
O97370 Eur m 3 261 344 85.1 2.5e-18
AAM10779 Blo t 3.0101 266 340 84.2 4.8e-18
P49276 Der f 6 279 247 63.0 1.2e-11
AAP57077 Der p 9.0101 273 229 58.9 2.1e-10
AAN02511 Der p 9.0102 261 227 58.4 2.7e-10
AAQ24544 Blo t 6.0101 275 222 57.3 6.3e-10
11692115 Bom t 4.0101 20 149 44.3 3.7e-07
3989146 Pol e 4.0101 241 131 36.6 0.00094
P86333 Mus a 3.0101 39 88 31.4 0.0054
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bom p 4.0101 Sequence ID: Q7M4I3

 Score = 392.2 bits 1691,  Expect = 9e-111
 Identities = 243/243 100%, Positives = 243/243 100%, Gaps = 0/243 0%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
            VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR
Sbjct  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
Query  61   IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRPICLPI 120
            IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRPICLPI
Sbjct  61   IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRPICLPI 120
Query  121  EESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAYSDVSDTVICAG 180
            EESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAYSDVSDTVICAG
Sbjct  121  EESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAYSDVSDTVICAG 180
Query  181  YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTSYLDSFILPA 240
            YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTSYLDSFILPA
Sbjct  181  YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTSYLDSFILPA 240
Query  241  LKK 243
            LKK
Sbjct  241  LKK 243

Sequence Alignment: 2. Allergen Name: Api m 7 Sequence ID: AAN02286

 Score = 108.0 bits 445,  Expect = 5e-25
 Identities = 80/222 36%, Positives = 121/222 54%, Gaps = 20/222 9%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSL--YV 58
            +VGG    +  +P M  +    Y      P   CG ++   R+VLTAAHC I  +     
Sbjct  161  IVGGTNTGINEFPMMAGIK-RTYE-----PGMICGATIISKRYVLTAAHCIIDENTTKLA 214
Query  59   VRIADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHD----DIAILKLEKDVSFSEYIR 114
            + + + +     +    +   I   +IHP Y   E  D    DIA+LK EKD+ F + + 
Sbjct  215  IVVGEHDWSSKTETNATVLHSINKVIIHPKYDIIEKDDWQINDIALLKTEKDIKFGDKVG 274
Query  115  PICLPIEESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAYSDVSD 174
            P CLP +  L  ++F G +  V GWG   + G LS  L +  + ++    C + Y ++  
Sbjct  275  PACLPFQHFL--DSFAGSDVTVLGWGHTSFNGMLSHILQKTTLNMLTQVECYKYYGNIMV 332
Query  175  TVICAGYPKGRKDSCQGDSGGPLMI--PQESTYYEIGVVSYGHECALPKYPGVYTRVTSY 232
              +CA Y KG KD+CQ DSGGP++   P+      IG++S+G EC   KYP   T+V SY
Sbjct  333  NAMCA-YAKG-KDACQMDSGGPVLWQNPRTKRLVNIGIISWGAECG--KYPNGNTKVGSY 388
Query  233  LD 234
            +D
Sbjct  389  ID 390

Sequence Alignment: 3. Allergen Name: Pol d 4.0101 Sequence ID: AAP37412

 Score = 96.9 bits 396,  Expect = 7e-22
 Identities = 78/223 34%, Positives = 124/223 55%, Gaps = 22/223 9%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHC--AIHRSLYV 58
            +V G   ++  +P MVA      R    SP   CGG++   +H++TAAHC     R+ Y 
Sbjct  34   IVNGVETEINEFP-MVA------RLIYPSPGMYCGGTIITPQHIVTAAHCLQKYKRTNYT 86
Query  59   ---VRIADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRP 115
               V + + +   D +     +  I    IHP+Y  + H++DIAI+K  +   +S  + P
Sbjct  87   GIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNY--NSHNNDIAIVKTNERFEYSMKVGP 144
Query  116  ICLPIEESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAY-SDVSD 174
            +CLP     RN  +        GWG+LRY G  S  L +V + V+  + C+  Y + +++
Sbjct  145  VCLPFNYMTRN--LTNETVTALGWGKLRYNGQNSKVLRKVDLHVITREQCETHYGAAIAN 202
Query  175  TVICAGYPKGRKDSCQGDSGGPLMI--PQESTYYEIGVVSYGHECALPKYPGVYTRVTSY 232
              +   +  GR D+CQ DSGGP++   P       +GVV++G  CA    PG   RVTS+
Sbjct  203  ANLLCTFDVGR-DACQNDSGGPILWRSPTTDNLILVGVVNFGRTCA-DDAPGGNARVTSF 260
Query  233  LDSFI 237
            ++ FI
Sbjct  261  ME-FI 264

Sequence Alignment: 4. Allergen Name: Can f 5.0101 Sequence ID: P09582

 Score = 91.5 bits 372,  Expect = 3e-20
 Identities = 78/212 36%, Positives = 124/212 58%, Gaps = 34/212 16%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
            ++GG+     + PW VA+ +HN        E+ CGG L     VLTAAHCA   S   V 
Sbjct  25   IIGGRECLKNSQPWQVAV-YHN-------GEFACGGVLVNPEWVLTAAHCA--NSNCEVW 74
Query  61   IADLNLKRDDDGAHPIQMGIESKLIHPDY-------VYSEHHD---DIAILKLEKDVSFS 110
            +   NL   +D  + +Q  +   +IHP Y       V     D   D+ +L LE+    +
Sbjct  75   LGRHNLSESEDEGQLVQ--VRKSFIHPLYKTKVPRAVIRPGEDRSHDLMLLHLEEPAKIT 132
Query  111  EYIRPICLPIEESLRNNNFIGYNPFVAGWGRLRYKGPLSD-ALMEVQVPVVRNKVCKRAY 169
            + +R + LP +E       +G   +V+GWG    +  +   +L  V + ++ N  C + Y
Sbjct  133  KAVRVMDLPKKEPP-----LGSTCYVSGWGSTDPETIFHPGSLQCVDLKLLSNNQCAKVY 187
Query  170  SD-VSDTVICAGYPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHE-CALPKYPGVYT 227
            +  V+  ++CAG  +G+KD+C+GDSGGPL+   E     +G+ S+G   C  P+ P +YT
Sbjct  188  TQKVTKFMLCAGVLEGKKDTCKGDSGGPLICDGEL----VGITSWGATPCGKPQMPSLYT 243
Query  228  RVTSYL 233
            RV  +L
Sbjct  244  RVMPHL 249

Sequence Alignment: 5. Allergen Name: Der f 3 Sequence ID: P49275

 Score = 90.3 bits 367,  Expect = 7e-20
 Identities = 81/217 37%, Positives = 125/217 57%, Gaps = 24/217 11%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
            +VGG  A+ G  P+ ++L         +S    CGGS+     +LTAAHC   +S   + 
Sbjct  28   IVGGVKAQAGDCPYQISL---------QSSSHFCGGSILDEYWILTAAHCVNGQSAKKLS 78
Query  61   IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEY-IRPICLP 119
            I   N  +   G   IQ  +     H +Y      +D+A++KL+  +++ +   +P+ LP
Sbjct  79   IR-YNTLKHASGGEKIQ--VAEIYQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLP 135
Query  120  IEESLRNNNFIGYNPFVAGWGRLRYKG-PLSDALMEVQVPVVRNKVCKRAYS----DVSD 174
             + S   +  +G    V+GWG L+     L   L  V + VV  + C + YS    DVS+
Sbjct  136  AQGS---DVKVGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSE 192
Query  175  TVICAG-YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTSYL 233
             +IC G    G  DSCQGDSGGP++    +T   +G+VS+G+ CA   YPGVYTRV +++
Sbjct  193  NMICGGDVANGGVDSCQGDSGGPVV--DVATKQIVGIVSWGYGCARKGYPGVYTRVGNFV 250
Query  234  D 234
            D
Sbjct  251  D 251

Sequence Alignment: 6. Allergen Name: Der p 3 Sequence ID: P39675

 Score = 89.9 bits 365,  Expect = 9e-20
 Identities = 78/217 35%, Positives = 125/217 57%, Gaps = 24/217 11%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
            +VGG+ A  G  P+ ++L         +S    CGG++     +LTAAHC   ++   + 
Sbjct  30   IVGGEKALAGECPYQISL---------QSSSHFCGGTILDEYWILTAAHCVAGQTASKLS 80
Query  61   IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEY-IRPICLP 119
            I   +LK    G    ++ +   + H  Y   +  +DIA++KL+  + +++   + + LP
Sbjct  81   IRYNSLKHSLGGE---KISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLP 137
Query  120  IEESLRNNNFIGYNPFVAGWGRLRYKG-PLSDALMEVQVPVVRNKVCKRAYS----DVSD 174
             + S   +  +G    V+GWG L      L   L  V + VV  K C   YS    +V+D
Sbjct  138  AKGS---DVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTD 194
Query  175  TVICAG-YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTSYL 233
             +IC G    G KDSCQGDSGGP++  + +    +G+VS+G+ CA   YPGVYTRV +++
Sbjct  195  NMICGGDVANGGKDSCQGDSGGPVVDVKNNQV--VGIVSWGYGCARKGYPGVYTRVGNFI 252
Query  234  D 234
            D
Sbjct  253  D 253

Sequence Alignment: 7. Allergen Name: Tyr p 3.0101 Sequence ID: ABZ81991

 Score = 88.9 bits 361,  Expect = 2e-19
 Identities = 87/216 40%, Positives = 125/216 57%, Gaps = 36/216 16%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSL---- 56
            +VGG  A  G  P  V+L   ++          CGGS+   R +LTAAHC     L    
Sbjct  34   IVGGTEAVDGDAPHQVSLQHTSHF---------CGGSIISERWILTAAHCIDADDLSNPG 84
Query  57   -YVVRIADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEY-IR 114
               VR   LNLK    G     + ++S  +H  Y      +DIA+L+    +++++    
Sbjct  85   GMSVRYNTLNLK---SGT---LVKVKSIKVHEQYSNVTSDNDIALLETVASMNLNQTNAV 138
Query  115  PICLPIEESLRNNNFIGYNPFVAGWGRLRYKGPLS--DALMEVQVPVVRNKVCKRAYS-- 170
               LP     + N+    + F++GWG L + G  +    L +V VP+    VC  AY+  
Sbjct  139  AAKLPA----KGNDPQDGDLFLSGWGTL-HSGDTTIPTNLQKVTVPLTNRSVCAEAYTGI 193
Query  171  -DVSDTVICAG-YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTR 228
             ++++ + CAG    G  DSCQGDSGG  M+ +E     +GVVS+G  C  PKYPGVYTR
Sbjct  194  VNITENMFCAGKMGIGGVDSCQGDSGGGAMLNKE----LVGVVSFGVGCGDPKYPGVYTR 249
Query  229  VTSYLDSFILPA 240
            V+ YLD   L A
Sbjct  250  VSQYLDWIELSA 261

Sequence Alignment: 8. Allergen Name: Eur m 3 Sequence ID: O97370

 Score = 85.1 bits 344,  Expect = 3e-18
 Identities = 77/215 35%, Positives = 127/215 59%, Gaps = 28/215 13%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
            +VGG+ AK G  P+ ++L         +S    CGG++     +LTAAHC   ++   + 
Sbjct  30   IVGGQKAKAGECPYQISL---------QSSSHFCGGTILDEYWILTAAHCVNGQTASKLS 80
Query  61   IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEY-IRPICLP 119
            I   +LK    G    ++ +     H  Y      +DIA++KL+  +++ +   + + LP
Sbjct  81   IRYNSLKHASGGE---KLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLP 137
Query  120  IEESLRNNNFIGYNPFVAGWGRLR---YKGPLSDALMEVQVPVVRNKVCKRAYSD----V 172
               S  ++  +G    V+GWG L+   Y  P SD +  V + +V  + C + Y +    +
Sbjct  138  ---SQGSDVKVGDKVRVSGWGYLKEGSYSLP-SD-MYRVDIDIVAREQCNKLYEEAGATI 192
Query  173  SDTVICAG-YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTS 231
            +D +IC G    G  DSCQGDSGGP++    ++   +G+VS+G+ CA   YPGVYTRV S
Sbjct  193  TDNMICGGNVADGGVDSCQGDSGGPVV--DVASNQIVGIVSWGYGCARKGYPGVYTRVGS 250
Query  232  YLD 234
            ++D
Sbjct  251  FID 253

Sequence Alignment: 9. Allergen Name: Blo t 3.0101 Sequence ID: AAM10779

 Score = 84.2 bits 340,  Expect = 5e-18
 Identities = 79/211 37%, Positives = 122/211 57%, Gaps = 32/211 15%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHC--AIHRSLYV 58
            +VGG  A  G  P+ V+L        +++  + CGGS+    ++LTAAHC   +  S   
Sbjct  36   IVGGSNAADGDAPYQVSL--------QRTSHF-CGGSIIADNYILTAAHCIQGLSASSLT 86
Query  59   VRIADLNLKRDDDGAHPIQMGIESKLI-HPDYVYSEHHDDIAILKLEKDVSF-SEYIRPI 116
             R    N  R + G   ++    S++I H  Y  +   +DIA+++    +S  +   + I
Sbjct  87   TRY---NTLRHNSGGLTVKA---SRIIGHEKYDSNTIDNDIALIQTASKMSTGTTNAQAI 140
Query  117  CLPIEESLRNNNFIGYNPFVAGWGRLRY-KGPLSDALMEVQVPVVRNKVCKRAY----SD 171
             LP + S   +       ++ GWG L      L   L +V VP+V  K C   Y    ++
Sbjct  141  KLPEQGS---DPKASSEVLITGWGTLSSGASSLPTKLQKVTVPIVDRKTCNANYGAVGAE 197
Query  172  VSDTVICAGYPK-GRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVT 230
            ++D + CAG    G KD+CQGDSGGP+     +    +G VS+G+ CA  KYPGVYTRV 
Sbjct  198  ITDNMFCAGILNVGGKDACQGDSGGPVA----ANGVLVGAVSWGYGCAQAKYPGVYTRVG 253
Query  231  SYL 233
            +Y+
Sbjct  254  NYI 256

Sequence Alignment: 10. Allergen Name: Der f 6 Sequence ID: P49276

 Score = 63.0 bits 247,  Expect = 1e-11
 Identities = 65/218 29%, Positives = 105/218 48%, Gaps = 21/218 9%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
            VVGG+ A L   P+ ++L + +Y   K+     CGGSL     V+TAAHC   +    + 
Sbjct  50   VVGGQDADLAEAPFQISL-LKDYLIMKRH---MCGGSLISESTVVTAAHCTYGQKASSLS 105
Query  61   IADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRPICLPI 120
            +     +R       ++  ++  + H  Y   + + D  I+ L   V  S  ++   +  
Sbjct  106  VRYGTNQRTSSSYGDLK--VKPIIQHESYEQDQTQTDKTIIILPNPVVPSTNVQMNEIET 163
Query  121  EESLRNNNFIGYNPFVAGWGRLRYKGP-LSDALMEVQVPVVRNKVCKRAYSDVSDT---V 176
            E+ +  +    Y     GWG     G  L D L +  + +V N  C   +  ++     +
Sbjct  164  EDIVDGDKVTIY-----GWGLTDGNGKDLPDKLQKGSMTIVGNDRCNEKWGSINAIHPGM 218
Query  177  ICAGYPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYG-HECALPKYPGVYTRVTSYLD 234
            ICA   K  +  C GDSGGPL+          G+VS+G  +C   +Y  V+TR   YLD
Sbjct  219  ICA-LDK-TQSGCNGDSGGPLVSANRKL---TGIVSWGPSKCPPGEYMSVFTRPKYYLD 272

Sequence Alignment: 11. Allergen Name: Der p 9.0101 Sequence ID: AAP57077

 Score = 58.9 bits 229,  Expect = 2e-10
 Identities = 74/206 35%, Positives = 105/206 50%, Gaps = 33/206 16%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHR----SL 56
            +VGG  A  G   + +AL    +R+      + CGGSL  SR VLTAAHC        S 
Sbjct  50   IVGGSNASPGDAVYQIAL----FRKDS----FTCGGSLISSRTVLTAAHCVFGDEATPSY 101
Query  57   YVVRIADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRPI 116
            + +R   L    D     PI  G+     H  Y  S    D+A L L +   F+      
Sbjct  102  FKIRYNTL----DRTNGPPI--GVSKIYRHNLYSSSPIDYDVATLILSQ--PFTPSANAD 153
Query  117  CLPIEESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAYSDV---S 173
             +P+  S   +   G    + GWGRL+  G L   L    V  +    C   +  V   +
Sbjct  154  IIPLTTSEPAD---GTKLQITGWGRLKSGGTLPTILQIASVTKMSRTKCSSTWGSVNAIT 210
Query  174  DTVICAGYPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYG-HECALPKYPGVYTRVTS 231
            + ++CA      + SC GDSGGPL+    S  + +GVVS+G   C   KYP +Y+ V +
Sbjct  211  NRMLCAH--NSNQASCNGDSGGPLV----SNGHLVGVVSWGPSTCLSTKYPTIYSNVAN 263

Sequence Alignment: 12. Allergen Name: Der p 9.0102 Sequence ID: AAN02511

 Score = 58.4 bits 227,  Expect = 3e-10
 Identities = 60/177 33%, Positives = 88/177 49%, Gaps = 28/177 15%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHR----SL 56
            +VGG  A  G   + +AL    +R+      + CGGSL  SR VLTAAHC        S 
Sbjct  64   IVGGSNASPGDAVYQIAL----FRKDS----FTCGGSLISSRTVLTAAHCVFGDEATPSY 115
Query  57   YVVRIADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRPI 116
            + +R   L      D  +   +G+     H  Y  S    D+A L L +   F+      
Sbjct  116  FKIRYNTL------DRTNGPTIGVSKIYRHNLYSSSTIDYDVATLILSQP--FTPSANAD 167
Query  117  CLPIEESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAYSDV---S 173
             +P+  S   +   G    + GWGRL+  G L   L    V  +    C   +  V   +
Sbjct  168  IIPLTTSEPAD---GTKLQITGWGRLKSGGTLPTILQIASVTKMSRTKCSSTWGSVNAIT 224
Query  174  DTVICAGYPKGRKDSCQGDSGGPLM 198
            + ++CA     ++ SC GDSGGPL+
Sbjct  225  NRMLCAH--NSKQASCNGDSGGPLV 247

Sequence Alignment: 13. Allergen Name: Blo t 6.0101 Sequence ID: AAQ24544

 Score = 57.3 bits 222,  Expect = 6e-10
 Identities = 72/213 33%, Positives = 116/213 54%, Gaps = 30/213 14%
Query  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
            VVGG  AK    P+ ++L   +Y   K      CGGSL   + V+TAAHC   ++   + 
Sbjct  47   VVGGTDAKKAEAPFQISL-MKDYLILKSH---ICGGSLITPQTVVTAAHCTDGQTASSL- 101
Query  61   IADLNLKRDDDGAHPIQMGIESKLI--HPDYVYSEHHDDIAILKLEKDVSFSEYIRPICL 118
               +N    +  + P    I++K I  H  Y  +   +DI++L L   ++ S+ ++ I  
Sbjct  102  ---INRLGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDISLLILASPITPSDTVKVIA- 157
Query  119  PIEESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQV---PVVRNKVCKRAYSDVSDT 175
             IEE+  N    G +  + GWG     G   D    +QV    +V  + C   + +V+  
Sbjct  158  -IEETNLNG---GEDVKLYGWGLT--DGNTQDLPENLQVGELKIVSQEECNAKWGEVNTI 211
Query  176  ---VICAGYPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYG-HECALPKYPGVYTRVTS 231
               +ICA  P  +  +C GDSGGPL+   +      G+VS+G  +C + +Y  V+TR   
Sbjct  212  KPGMICALAPSTQ--ACNGDSGGPLVYNGKLA----GIVSWGPSKCPVGEYMAVFTRPNH 265
Query  232  YLD 234
            YL+
Sbjct  266  YLE 268

Sequence Alignment: 14. Allergen Name: Bom t 4.0101 Sequence ID: 11692115

 Score = 44.3 bits 149,  Expect = 4e-07
 Identities = 20/20 100%, Positives = 20/20 100%, Gaps = 0/20 0%
Query  1    VVGGKPAKLGAWPWMVALGF 20
            VVGGKPAKLGAWPWMVALGF
Sbjct  1    VVGGKPAKLGAWPWMVALGF 20

Sequence Alignment: 15. Allergen Name: Pol e 4.0101 Sequence ID: 3989146

 Score = 36.6 bits 131,  Expect = 0.0009
 Identities = 29/99 29%, Positives = 46/99 46%, Gaps = 13/99 13%
Query  34   CGGSLRIS--RHVLTAAHCA--IHRSLYVVRIADLNLKRDDDGAHPIQMGIESKLIHPDY 89
            CGG++     +H+LTAAHC             +      D    + I++      IHP+Y
Sbjct  27   CGGTIITPPFKHILTAAHCVEGFLDPTLXXXXSTTGETYDLSXXYTIKV-----TIHPNY 81
Query  90   VYSEHHDDIAILKLEKDVSFSEYIRPICLPIEESLRNNNFIGYNPFVAGWGR 141
               +H +DI+I+           + P+CLP   +  N  F        GWG+
Sbjct  82   F--DHDNDISIVLXXXXXXXXXXVGPVCLPF--NYMNRVFTDVTVTALGWGK 129

Sequence Alignment: 16. Allergen Name: Mus a 3.0101 Sequence ID: P86333

 Score = 31.4 bits 88,  Expect = 0.005
 Identities = 14/30 46%, Positives = 18/30 60%, Gaps = 4/30 13%
Query  165  CKRAYSDVSDTVICAGYPKGRKDSCQGD-SGGPL 197
            C + Y D+   + C GY KG   +C G   GGPL
Sbjct  3    CSKVYGDI---ISCVGYIKGGPIACVGYLKGGPL 33

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.