The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ
SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKK
ETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALRE
KVLGLPAIKAWVAKRPPTDL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB72147 Bla g 5 200 1363 317.6 1.6e-88
O18598 Bla g 5 203 1363 317.6 1.7e-88
P46436 Asc l 13.0101w 206 437 106.5 5.9e-25
P46436 Asc s 13.0101 206 437 106.5 5.9e-25
AGG10560 Tyr p 8.0101 218 278 70.2 5.2e-14
AGC56215 Der f 8.0101 197 250 63.9 3.8e-12
P46419 Der p 8 219 215 55.8 1.1e-09
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bla g 5 Sequence ID: AAB72147

 Score = 317.6 bits 1363,  Expect = 2e-88
 Identities = 200/200 100%, Positives = 200/200 100%, Gaps = 0/200 0%
Query  1    YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ 60
            YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ
Sbjct  1    YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ 60
Query  61   SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKK 120
            SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKK
Sbjct  61   SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKK 120
Query  121  ETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALRE 180
            ETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALRE
Sbjct  121  ETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALRE 180
Query  181  KVLGLPAIKAWVAKRPPTDL 200
            KVLGLPAIKAWVAKRPPTDL
Sbjct  181  KVLGLPAIKAWVAKRPPTDL 200

Sequence Alignment: 2. Allergen Name: Bla g 5 Sequence ID: O18598

 Score = 317.6 bits 1363,  Expect = 2e-88
 Identities = 200/200 100%, Positives = 200/200 100%, Gaps = 0/200 0%
Query  1    YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ 60
            YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ
Sbjct  4    YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ 63
Query  61   SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKK 120
            SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKK
Sbjct  64   SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKK 123
Query  121  ETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALRE 180
            ETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALRE
Sbjct  124  ETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALRE 183
Query  181  KVLGLPAIKAWVAKRPPTDL 200
            KVLGLPAIKAWVAKRPPTDL
Sbjct  184  KVLGLPAIKAWVAKRPPTDL 203

Sequence Alignment: 3. Allergen Name: Asc l 13.0101w Sequence ID: P46436

 Score = 106.5 bits 437,  Expect = 6e-25
 Identities = 79/194 40%, Positives = 112/194 57%, Gaps = 11/194 5%
Query  1    YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ 60
            YKLTY  ++ LGE  R+++      FED R++  DWP LKP  PFG+ P+LE+DG+   Q
Sbjct  4    YKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEVLAQ 63
Query  61   SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAI-ANYHYDA--DENSKQKKWDP 117
            S AI RYLG+QFGL+GK   E  ++D I D   DF A +   +   A  +E  K+K    
Sbjct  64   SAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV--- 120
Query  118  LKKETIPYYTKKFDEVVK--ANGG--YLAAGKLTWADFYFVAILDYLNHMAKEDLVANQP 173
            LK+  +P   K +  + K  A  G  Y+    +TWAD+     L     +   D+++ + 
Sbjct  121  LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIP-DFLSGHL 179
Query  174  NLKALREKVLGLPAIKAWVAKRPPT 198
             LK   E V  LP IK W+A+RP T
Sbjct  180  QLKKYIEHVRELPNIKKWIAERPKT 204

Sequence Alignment: 4. Allergen Name: Asc s 13.0101 Sequence ID: P46436

 Score = 106.5 bits 437,  Expect = 6e-25
 Identities = 79/194 40%, Positives = 112/194 57%, Gaps = 11/194 5%
Query  1    YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ 60
            YKLTY  ++ LGE  R+++      FED R++  DWP LKP  PFG+ P+LE+DG+   Q
Sbjct  4    YKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEVLAQ 63
Query  61   SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAI-ANYHYDA--DENSKQKKWDP 117
            S AI RYLG+QFGL+GK   E  ++D I D   DF A +   +   A  +E  K+K    
Sbjct  64   SAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV--- 120
Query  118  LKKETIPYYTKKFDEVVK--ANGG--YLAAGKLTWADFYFVAILDYLNHMAKEDLVANQP 173
            LK+  +P   K +  + K  A  G  Y+    +TWAD+     L     +   D+++ + 
Sbjct  121  LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIP-DFLSGHL 179
Query  174  NLKALREKVLGLPAIKAWVAKRPPT 198
             LK   E V  LP IK W+A+RP T
Sbjct  180  QLKKYIEHVRELPNIKKWIAERPKT 204

Sequence Alignment: 5. Allergen Name: Tyr p 8.0101 Sequence ID: AGG10560

 Score = 70.2 bits 278,  Expect = 5e-14
 Identities = 58/188 30%, Positives = 107/188 56%, Gaps = 16/188 8%
Query  3    LTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGD------WPNLKPSM--PFGKTPVLEID 54
            L Y  ++ L +PIR+LL+Y + D+ED R+Q G       W   K ++   F   P   ID
Sbjct  7    LGYWDIRGLAQPIRLLLAYLDVDYEDKRYQLGANFDRSAWLTEKFNLGLDFPNLPYY-ID 65
Query  55   GK-QTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQK 113
            G  +  Q++AI RY+G+++ L+G ++ E L + ++   + D   +++   YD   N+ + 
Sbjct  66   GNVKLSQTLAILRYIGRKYKLTGANEPEELRVSLVEQQVVDGNQSLSRVAYDP--NADKL 123
Query  114  KWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQP 173
            K D LK  T+P   K++   +  N  ++A   +T+ DF++   L  L+ +  E +     
Sbjct  124  KPDFLK--TLPDSVKQLSHFL-GNSPFVAGTSITYVDFWLYEYLVKLSVLVPE-VFGQFD 179
Query  174  NLKALREKVLGLPAIKAWVAKRPP 197
            NLK + E++  LP +  ++  + P
Sbjct  180  NLKKFVERIESLPRVSVYIKAQQP 203

Sequence Alignment: 6. Allergen Name: Der f 8.0101 Sequence ID: AGC56215

 Score = 63.9 bits 250,  Expect = 4e-12
 Identities = 60/173 34%, Positives = 95/173 54%, Gaps = 18/173 10%
Query  18   LLSYGEKDFEDYRFQEG------DWPNLKPSM--PFGKTPVLEIDGK-QTHQSVAISRYL 68
            +L+Y   D+ D R+  G      +W N K ++   F   P   +DG  +  QS+AI RYL
Sbjct  1    MLAYAGVDYVDKRYNIGPNFDRSEWLNEKFNLGLDFPNLPYY-MDGDVKITQSMAILRYL 59
Query  69   GKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTK 128
             +++ + G ++ E L I M      D   A+    YD   N +  + D LK  T+P   K
Sbjct  60   ARKYNMDGTNEQERLRISMAEQQTHDMFMAMVRICYD--PNMENLRVDYLK--TLPDSLK 115
Query  129  KFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQ-PNLKALREKVLGLPA 187
              ++ + AN  Y+A  K+++ADFY+   L  +  M  E  V  Q  NLK + E++  LP 
Sbjct  116  LMEKFL-ANHDYIAGSKISYADFYLYEYLCRMKVMVPE--VYGQFENLKKFVERIESLPR 172
Query  188  IKAWVAKRPPT 198
            I  ++ K+ PT
Sbjct  173  IAEYIKKQKPT 183

Sequence Alignment: 7. Allergen Name: Der p 8 Sequence ID: P46419

 Score = 55.8 bits 215,  Expect = 1e-09
 Identities = 62/188 32%, Positives = 99/188 52%, Gaps = 18/188 9%
Query  3    LTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPS----------MPFGKTPVLE 52
            L Y  ++   +PIR+LL+Y   DF D R+Q G  P++  S          + F   P   
Sbjct  6    LGYWDIRGYAQPIRLLLTYSGVDFVDKRYQIGPAPDFDRSEWLNEKFNLGLDFPNLPYY- 64
Query  53   IDGK-QTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSK 111
            IDG  +  Q+ AI RYLG+++ L+G +D E + I M      D  AA+    YDA  N  
Sbjct  65   IDGDMKMTQTFAILRYLGRKYKLNGSNDHEEIRISMAEQQTEDMMAAMIRVCYDA--NCD 122
Query  112  QKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVAN 171
            + K D LK  ++P   K   + V     ++A   +++ DF +   L ++  M  E +   
Sbjct  123  KLKPDYLK--SLPDCLKLMSKFV-GEHAFIAGANISYVDFNLYEYLCHVKVMVPE-VFGQ 178
Query  172  QPNLKALREKVLGLPAIKAWVAKRPP 197
              NLK   E++  LP +  ++ K+ P
Sbjct  179  FENLKRYVERMESLPRVSDYIKKQQP 204

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.