The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

YVSLSPDSVFNIITDDISHQILSRSNCERSKRPKRVFSIYWNVPTFMCHQYGMNFDEVTD
FNIKHNSKDNFRGETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDL
DKMTPDKNFGGIGVIDFERWKPIFRQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATK
KFEKYARYFMEETLKLAKKTRKRAKWGYYGFPYCYNVTPNNPGPDCDAKATIENDRLSWM
YNNQEILFPSVYVRHEQKPEERVYLVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDI
YLSETDVEKTFQEIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN
GRSSLNF
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9U6V9 Pol a 2 367 2526 582.2 1.2e-167
XP_015179722 Pol d 2.0101 365 2277 525.4 1.5e-150
P86687 Poly p 2.0101 288 1903 440.3 5e-125
P49371 Dol m 2 331 1845 427.0 5.7e-121
P49370 Ves v 2.0101 331 1791 414.7 2.9e-117
AAX14718 Ves v 2.0201 340 1436 333.8 6.8e-93
Q08169 Api m 2 382 1267 295.2 3.1e-81
ADM18346 Tab y 2.0101 349 910 213.9 8.7e-57
6736487 Ves m 2.0101 31 128 40.1 1.6e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol a 2 Sequence ID: Q9U6V9

 Score = 582.2 bits 2526,  Expect = 1e-167
 Identities = 367/367 100%, Positives = 367/367 100%, Gaps = 0/367 0%
Query  1    YVSLSPDSVFNIITDDISHQILSRSNCERSKRPKRVFSIYWNVPTFMCHQYGMNFDEVTD 60
            YVSLSPDSVFNIITDDISHQILSRSNCERSKRPKRVFSIYWNVPTFMCHQYGMNFDEVTD
Sbjct  1    YVSLSPDSVFNIITDDISHQILSRSNCERSKRPKRVFSIYWNVPTFMCHQYGMNFDEVTD 60
Query  61   FNIKHNSKDNFRGETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDL 120
            FNIKHNSKDNFRGETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDL
Sbjct  61   FNIKHNSKDNFRGETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDL 120
Query  121  DKMTPDKNFGGIGVIDFERWKPIFRQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATK 180
            DKMTPDKNFGGIGVIDFERWKPIFRQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATK
Sbjct  121  DKMTPDKNFGGIGVIDFERWKPIFRQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATK 180
Query  181  KFEKYARYFMEETLKLAKKTRKRAKWGYYGFPYCYNVTPNNPGPDCDAKATIENDRLSWM 240
            KFEKYARYFMEETLKLAKKTRKRAKWGYYGFPYCYNVTPNNPGPDCDAKATIENDRLSWM
Sbjct  181  KFEKYARYFMEETLKLAKKTRKRAKWGYYGFPYCYNVTPNNPGPDCDAKATIENDRLSWM 240
Query  241  YNNQEILFPSVYVRHEQKPEERVYLVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDI 300
            YNNQEILFPSVYVRHEQKPEERVYLVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDI
Sbjct  241  YNNQEILFPSVYVRHEQKPEERVYLVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDI 300
Query  301  YLSETDVEKTFQEIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN 360
            YLSETDVEKTFQEIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN
Sbjct  301  YLSETDVEKTFQEIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN 360
Query  361  GRSSLNF 367
            GRSSLNF
Sbjct  361  GRSSLNF 367

Sequence Alignment: 2. Allergen Name: Pol d 2.0101 Sequence ID: XP_015179722

 Score = 525.4 bits 2277,  Expect = 1e-150
 Identities = 327/342 95%, Positives = 336/342 98%, Gaps = 1/342 0%
Query  26   NCERSKRPKRVFSIYWNVPTFMCHQYGMNFDEVTDFNIKHNSKDNFRGETISIYYDPGKF 85
            NCE SKRPKRVFSIYWNVPTFMCHQYGMNFDEVTDFNIKHNSKDNFRGETI+IYYDPGKF
Sbjct  23   NCESSKRPKRVFSIYWNVPTFMCHQYGMNFDEVTDFNIKHNSKDNFRGETIAIYYDPGKF 82
Query  86   PALMPLKN-GNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGIGVIDFERWKPIF 144
            PALMPL N G YEERNGGVPQ GNITIHLQQFNEDLDKMTPD+NFGGIGVIDFERW+PIF
Sbjct  83   PALMPLNNNGKYEERNGGVPQLGNITIHLQQFNEDLDKMTPDRNFGGIGVIDFERWRPIF 142
Query  145  RQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKTRKRA 204
            RQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKK+RKRA
Sbjct  143  RQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKSRKRA 202
Query  205  KWGYYGFPYCYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVYVRHEQKPEERVY 264
            KWGYYGFPYCYNVTPNNPGPDCDAKA IENDRLSWMYNNQEIL+PSVY+RHEQKPEER+Y
Sbjct  203  KWGYYGFPYCYNVTPNNPGPDCDAKAIIENDRLSWMYNNQEILLPSVYLRHEQKPEERIY 262
Query  265  LVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDVEKTFQEIVTNGGDGIII 324
            LVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDV+KTFQEIVTNGG+GIII
Sbjct  263  LVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDVKKTFQEIVTNGGNGIII 322
Query  325  WGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVNGRSSLNF 367
            WGSSSDVNSLSKCKRLREYLLNTLGP AVNVTETVNGRSSLNF
Sbjct  323  WGSSSDVNSLSKCKRLREYLLNTLGPIAVNVTETVNGRSSLNF 365

Sequence Alignment: 3. Allergen Name: Poly p 2.0101 Sequence ID: P86687

 Score = 440.3 bits 1903,  Expect = 5e-125
 Identities = 275/288 95%, Positives = 281/288 97%, Gaps = 0/288 0%
Query  73   GETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGI 132
            GETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGI
Sbjct  1    GETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGI 60
Query  133  GVIDFERWKPIFRQNWGNTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEE 192
            GVIDFERWKPIFRQNWGNTEIHKKYSIELVR EHPKWSESMIEAEATKKFEKYAR FMEE
Sbjct  61   GVIDFERWKPIFRQNWGNTEIHKKYSIELVRYEHPKWSESMIEAEATKKFEKYARLFMEE 120
Query  193  TLKLAKKTRKRAKWGYYGFPYCYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVY 252
            TLKLAKKTRKRAKWGYYGFPYCYN TPNNPGPDCDAKA IENDRLSWMYNNQEILFPSVY
Sbjct  121  TLKLAKKTRKRAKWGYYGFPYCYNYTPNNPGPDCDAKAMIENDRLSWMYNNQEILFPSVY 180
Query  253  VRHEQKPEERVYLVQGRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDVEKTFQ 312
            VRHE  P++RVYLVQGRIKEAVRISNNL+HSP VL+YWWYVYQDKMDI+LSETDV+KTFQ
Sbjct  181  VRHELTPDQRVYLVQGRIKEAVRISNNLKHSPKVLSYWWYVYQDKMDIFLSETDVKKTFQ 240
Query  313  EIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN 360
            EIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN
Sbjct  241  EIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN 288

Sequence Alignment: 4. Allergen Name: Dol m 2 Sequence ID: P49371

 Score = 427.0 bits 1845,  Expect = 6e-121
 Identities = 252/331 76%, Positives = 295/331 89%, Gaps = 0/331 0%
Query  30   SKRPKRVFSIYWNVPTFMCHQYGMNFDEVTDFNIKHNSKDNFRGETISIYYDPGKFPALM 89
            S+RPKRVF+IYWNVPTFMCHQYG+ FDEVT+FNIKHNSKD+F+G+ ISI+YDPG+FPAL+
Sbjct  1    SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL 60
Query  90   PLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGIGVIDFERWKPIFRQNWG 149
            PLK GNY+ RNGGVPQ GNITIHLQ+F E+LDK  P++NF GIGVIDFERW+PIFRQNWG
Sbjct  61   PLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWG 120
Query  150  NTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKTRKRAKWGYY 209
            N  IHKK+SI+LVR EHP W + MIE EA+K+FEKYAR FMEETLKLAKKTRK+A WGYY
Sbjct  121  NMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYY 180
Query  210  GFPYCYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVYVRHEQKPEERVYLVQGR 269
            G+PYC+N++PNN  PDCDA A +END++SW++NNQ +L+PSVY+RHE  P++RV LVQGR
Sbjct  181  GYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGR 240
Query  270  IKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDVEKTFQEIVTNGGDGIIIWGSSS 329
            +KEAVRISNNL+HSP VL+YWWYVYQD  + +L+ETDV+KTFQEI  NGGDGIIIWGSSS
Sbjct  241  VKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSS 300
Query  330  DVNSLSKCKRLREYLLNTLGPFAVNVTETVN 360
            DVNSLSKCKRLREYLL  LGP  VNVTETVN
Sbjct  301  DVNSLSKCKRLREYLLTVLGPITVNVTETVN 331

Sequence Alignment: 5. Allergen Name: Ves v 2.0101 Sequence ID: P49370

 Score = 414.7 bits 1791,  Expect = 3e-117
 Identities = 241/331 72%, Positives = 296/331 89%, Gaps = 0/331 0%
Query  30   SKRPKRVFSIYWNVPTFMCHQYGMNFDEVTDFNIKHNSKDNFRGETISIYYDPGKFPALM 89
            S+RPKRVF+IYWNVPTFMCHQY + FDEVT+FNIK NSKD+F+G+ I+I+YDPG+FPAL+
Sbjct  1    SERPKRVFNIYWNVPTFMCHQYDLYFDEVTNFNIKRNSKDDFQGDKIAIFYDPGEFPALL 60
Query  90   PLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGIGVIDFERWKPIFRQNWG 149
             LK+G Y++RNGGVPQ GNITIHLQ+F E+LDK+ P++NF GIGVIDFERW+PIFRQNWG
Sbjct  61   SLKDGKYKKRNGGVPQEGNITIHLQKFIENLDKIYPNRNFSGIGVIDFERWRPIFRQNWG 120
Query  150  NTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKTRKRAKWGYY 209
            N +IHK +SI+LVR EHP W++ MIE EA+K+FEKYAR+FMEETLKLAKKTRK+A WGYY
Sbjct  121  NMKIHKNFSIDLVRNEHPTWNKKMIELEASKRFEKYARFFMEETLKLAKKTRKQADWGYY 180
Query  210  GFPYCYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVYVRHEQKPEERVYLVQGR 269
            G+PYC+N++PNN  P+CD  A  END++SW++NNQ +L+PSVYVR+E  P++R+ LVQGR
Sbjct  181  GYPYCFNMSPNNLVPECDVTAMHENDKMSWLFNNQNVLLPSVYVRQELTPDQRIGLVQGR 240
Query  270  IKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDVEKTFQEIVTNGGDGIIIWGSSS 329
            +KEAVRISNNL+HSP VL+YWWYVYQD+ + +L+ETDV+KTFQEIV NGGDGIIIWGSSS
Sbjct  241  VKEAVRISNNLKHSPKVLSYWWYVYQDETNTFLTETDVKKTFQEIVINGGDGIIIWGSSS 300
Query  330  DVNSLSKCKRLREYLLNTLGPFAVNVTETVN 360
            DVNSLSKCKRL++YLL  LGP A+NVTE VN
Sbjct  301  DVNSLSKCKRLQDYLLTVLGPIAINVTEAVN 331

Sequence Alignment: 6. Allergen Name: Ves v 2.0201 Sequence ID: AAX14718

 Score = 333.8 bits 1436,  Expect = 7e-93
 Identities = 191/340 56%, Positives = 264/340 77%, Gaps = 0/340 0%
Query  28   ERSKRPKRVFSIYWNVPTFMCHQYGMNFDEVTDFNIKHNSKDNFRGETISIYYDPGKFPA 87
            +R+  PK+ FSIYWN+PT  CH +G+ F E+  FNIK+NS +NFRGETIS++YDPG FP+
Sbjct  1    DRTIWPKKGFSIYWNIPTHFCHNFGVYFKELKQFNIKYNSMNNFRGETISLFYDPGNFPS 60
Query  88   LMPLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGIGVIDFERWKPIFRQN 147
            ++ LKNG YE RN GVPQ+GN+TIHL+QF ++LD++ P K  GGIGVI F  W+PIFR+N
Sbjct  61   MVLLKNGTYEIRNEGVPQKGNLTIHLEQFTKELDEIYPKKIAGGIGVIHFHNWRPIFRRN 120
Query  148  WGNTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKTRKRAKWG 207
              N +I+K  SI+LVRKEHPKW +SMIE EA+ +FE  A+ FME+TLKLAK+ RK+ +WG
Sbjct  121  VDNLKINKDISIDLVRKEHPKWDKSMIEKEASNRFETSAKIFMEKTLKLAKEIRKKTEWG 180
Query  208  YYGFPYCYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVYVRHEQKPEERVYLVQ 267
            Y+G+P+C + + + P  DCDA +  END++SW++NNQ +L+PS+Y+++  KP+E+++LVQ
Sbjct  181  YHGYPHCLSGSTDKPSFDCDALSMSENDKMSWLFNNQNVLLPSIYLKNVLKPDEKIHLVQ 240
Query  268  GRIKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDVEKTFQEIVTNGGDGIIIWGS 327
             R+KEA+RIS N++H P VL YWWY YQDK  I+L+E DV+ TF+EI+TNG DGIIIWG 
Sbjct  241  ERLKEAIRISKNFKHLPKVLPYWWYTYQDKESIFLTEADVKNTFKEILTNGADGIIIWGV 300
Query  328  SSDVNSLSKCKRLREYLLNTLGPFAVNVTETVNGRSSLNF 367
            S ++    +C++L+EYL+  LGP A  VT+ V   + LNF
Sbjct  301  SYELTDRKRCEKLKEYLMKILGPIAFKVTKAVKENTPLNF 340

Sequence Alignment: 7. Allergen Name: Api m 2 Sequence ID: Q08169

 Score = 295.2 bits 1267,  Expect = 3e-81
 Identities = 176/332 53%, Positives = 237/332 71%, Gaps = 4/332 1%
Query  35   RVFSIYWNVPTFMCHQYGMNFDEVTD-FNIKHNSKDNFRGETISIYYDPGKFPALMPLKN 93
            R F++YWNVPTFMCH+YG+ F+EV++ + I +N  D FRGE I+I YDPG FPAL+   N
Sbjct  41   REFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKDPN 100
Query  94   GNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGIGVIDFERWKPIFRQNWGNTEI 153
            GN   RNGGVPQ GN+T HLQ F + L    PDK+F G+GVIDFE W+PIFRQNW + + 
Sbjct  101  GNVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQP 160
Query  154  HKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKTRKRAKWGYYGFPY 213
            +KK S+E+VR+EHP W +  +E EA ++FEKY + FMEETLK AK+ R  A WGYY +PY
Sbjct  161  YKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPY 220
Query  214  CYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVYVRHEQKPEERVYLVQGRIKEA 273
            CYN+TPN P   C+A    END++SW++ ++++L+PSVY+R      ERV LV GR+KEA
Sbjct  221  CYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEA 280
Query  274  VRISNNLEHS-PSVLAYWWYVYQDKMDIYLSETDVEKTFQEIVTNGGDGIIIWGSSSDVN 332
            +RI+  +  S   VL Y+WY YQD+ D  LS  D+E T+++I   G DG IIWGSS D+N
Sbjct  281  LRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDIN 340
Query  333  SLSKCKRLREYLLNTLGPFA--VNVTETVNGRSSLN 366
            + +KC ++REYL N LGP    + +    N R +++
Sbjct  341  TKAKCLQFREYLNNELGPAVKRIALNNNANDRLTVD 376

Sequence Alignment: 8. Allergen Name: Tab y 2.0101 Sequence ID: ADM18346

 Score = 213.9 bits 910,  Expect = 9e-57
 Identities = 135/309 43%, Positives = 207/309 66%, Gaps = 16/309 5%
Query  35   RVFSIYWNVPTFMCHQYGMNFDEVTDFNIKH----NSKDNFRGETISIYYDPGKFPALMP 90
            R F +YWN+PTFMC         + D+N KH    N++D FRG+ IS+ Y PG FPA+  
Sbjct  24   RKFEVYWNIPTFMCPDQNKT---IMDLNKKHGVIQNTEDLFRGDKISLLYHPGAFPAITR 80
Query  91   LKNGN---YEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGIGVIDFERWKPIFRQN 147
             K  N   YE  NGGVPQ GN+++HL+ + +D+++   DKNF G+ VIDFE W+PIFRQN
Sbjct  81   NKTTNTLIYE--NGGVPQAGNLSLHLKLLEKDINEQITDKNFSGLAVIDFELWRPIFRQN 138
Query  148  WGNTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKTRKRAKWG 207
             G+   ++  S++L +  HP+++E  +  EA ++ EK+ R F+++TL  AKK R +A+WG
Sbjct  139  GGSLSDYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSFIKQTLIKAKKLRPKAQWG 198
Query  208  YYGFPYCYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVYVRHEQKPEERVYLVQ 267
            YY FPYC+N         C   A I+NDR+ +M+ N ++++P+VY++ +   + +  LV+
Sbjct  199  YYAFPYCFNGR-RRYVDTCIPSAKIDNDRILYMFENSDVIYPAVYLQTDLAQKNQTGLVK 257
Query  268  GRIKEAVRISNNLEH--SPSVLAYWWYVYQDKMDIYLSETDVEKTFQEIVTNGGDGIIIW 325
            GR+ EAVR++  ++    P VL Y  YV+ D ++ Y+S+ +    F+ +  NG DG+IIW
Sbjct  258  GRVDEAVRMAKMVKKPAKPPVLVYHRYVFTDTLE-YISKENTTAVFKAMKDNGADGVIIW 316
Query  326  GSSSDVNSLSKCKRLREYLLNTLGP 350
            GSS D+NS  KC ++ +YL   L P
Sbjct  317  GSSFDLNSKEKCAKFLDYLREVLWP 341

Sequence Alignment: 9. Allergen Name: Ves m 2.0101 Sequence ID: 6736487

 Score = 40.1 bits 128,  Expect = 2e-05
 Identities = 16/31 51%, Positives = 21/31 67%, Gaps = 0/31 0%
Query  28   ERSKRPKRVFSIYWNVPTFMCHQYGMNFDEV 58
            +R   PK  FSIYWN+PT  CH +G+ F E+
Sbjct  1    DRCIWPKEGFSIYWNIPTHFCHNFGVYFKEL 31

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.