The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 1562
Allergen Scientific Name Aes h 1.0101
Allergen Species - Systematic Name Aesculus hippocastanum
Allergen Species - Common Name Horse chestnut
Allergen Common source tree
Allergen Common name Aesculus hippocastanum
Allergen Keywords Defensin-like protein
Allergen IUIS (Yes=1, No=0) 1
Aes h 1.0101 - References
ID Reference
Pubmed ID: 10591099
Fant, F., Vranken, W.F. and Borremans, F.A. (1999), The three-dimensional solution structure of Aesculus hippocastanum antimicrobial protein 1 determined by 1H nuclear magnetic resonance. Proteins, 37: 388-403.
Aes h 1.0101 - Protein Sequences
Source Link to source
GenBank Q7M1F3
Aes h 1.0101 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
1562 307 1BK8 2000-01-05 Solution NMR The three-dimensional solution structure of Aesculus hippocastanum antimicrobial protein 1 determined by 1H nuclear magnetic resonance.
1BK8.pdb


Aes h 1.0101 - Sequence Search :
Sequence Header Sequence
Aes h 1.0101
SDAP Sequence ID: 1340
SDAP Allergen ID: 1562
LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Aes h 1.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Aes h 1.0101 92.5 0.67 1BK8_A 100 50 50 1 - 50 1 - 50 5.18e-32 105 Download (SI: 1340)
Aes h 1.0101 - Alphafold Theoretical Model Structure
Model Structure
1340_relaxed_rank_1_model_2.pdb


Coverage Plddt
Aes h 1.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q7M1F3 Click here to process the data
Aes h 1.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1340 1562 4 50 1 50 PF00304 Gamma-thionin Domain CL0054 Gamma-thionin family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Aes h 1.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.