The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP
Allergen Info Description
Allergen ID 523
Allergen Scientific Name Amb p 5
Allergen Species - Systematic Name Ambrosia psilostachya
Allergen Species - Common Name Western ragweed
Allergen Common source weed
Allergen Common name Asterales
Allergen Keywords N
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Amb p 5 - References
ID Reference
No reference found!
Amb p 5 - Protein Sequences
Source Link to source
SwissProt P43174
SwissProt P43175
GenBank 515954
GenBank 515956
GenBank 515957
Amb p 5 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
23 GetModel Model Pic Model Pic Model Pic Model Pic Click here
24 GetModel Model Pic Model Pic Model Pic Model Pic Click here
798 GetModel Model Pic Model Pic Model Pic Model Pic Click here
799 GetModel Model Pic Model Pic Model Pic Model Pic Click here
800 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Amb p 5 - Sequence Search :
Sequence Header Sequence
Amb p 5
SDAP Sequence ID: 23
SDAP Allergen ID: 523
MNNEKNVSFEFIGSTDEVDEIKLLPCAWAGNVCGEKRAYCCSDPGRYCPWQVVCYESSEICSQKCGKMRMNVTKNTI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Amb p 5
SDAP Sequence ID: 24
SDAP Allergen ID: 523
MNNEKNVSFEFIGSTNEVDEIKVMACYAAGSICGEKRGYCSSDPGRYCPWQVVCYESRKICAKNAAKMRMNVTKNTI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Amb p 5
SDAP Sequence ID: 798
SDAP Allergen ID: 523
MNNEKNVSFEFIGSTDEVDEIKLLPCAWAGNVCGEKRAYCCSDPGRYCPWQVVCYESSKICSQKCGKMRMNVTKNTI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Amb p 5
SDAP Sequence ID: 799
SDAP Allergen ID: 523
MNNEKNVSFEFIGSTNEVDEIKVMACYAAGSICGEKRGYSSSDPGRYCPWQVVCYESRKICAKNAAKMRMNVTKNTI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Amb p 5
SDAP Sequence ID: 800
SDAP Allergen ID: 523
MNNEKNVSFEFIGSTNEVDEIKVMACYAAGSICGEKRGYCCTNPGRYCPWQVVCYESRKICAKNAAKMRMNVTKNTI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Amb p 5 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Amb p 5 80.25 0.66 1BBG_A 48.571 35 77 30 - 64 8 - 38 0.014 31.6 Download (SI: 800)
Amb p 5 52.4 0.41 1BBG_A 45.946 37 77 30 - 66 8 - 40 0.036 30.4 Download (SI: 24)
Amb p 5 44.7 0.32 1BBG_A 44.737 38 77 28 - 65 6 - 39 0.005 32.7 Download (SI: 23)
Amb p 5 64.3 0.47 1BBG_A 43.243 37 77 30 - 66 8 - 40 0.23 28.5 Download (SI: 799)
Amb p 5 54.25 0.41 1BBG_A 44.737 38 77 28 - 65 6 - 39 0.005 32.7 Download (SI: 798)
Amb p 5 - Alphafold Theoretical Model Structure
Model Structure
800_relaxed_rank_1_model_2.pdb


Coverage Plddt
Amb p 5 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P43174 Click here to process the data
P43175 Click here to process the data
515954 Click here to process the data
515956 Click here to process the data
515957 Click here to process the data
Amb p 5 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
23 523 24 66 23 66 PF03913 Ragweed_pollen Family No_clan Ragweed group 5 pollen allergen
24 523 23 66 23 66 PF03913 Ragweed_pollen Family No_clan Ragweed group 5 pollen allergen
798 523 24 66 23 66 PF03913 Ragweed_pollen Family No_clan Ragweed group 5 pollen allergen
799 523 23 66 23 66 PF03913 Ragweed_pollen Family No_clan Ragweed group 5 pollen allergen
800 523 23 66 23 66 PF03913 Ragweed_pollen Family No_clan Ragweed group 5 pollen allergen
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Amb p 5 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.