The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP
Allergen Info Description
Allergen ID 1075
Allergen Scientific Name Api d 1.0101
Allergen Species - Systematic Name Apis dorsata
Allergen Species - Common Name Giant honeybee
Allergen Common source insects
Allergen Common name
Allergen Keywords Phospholipase A2
Allergen IUIS (Yes=1, No=0) 1
Api d 1.0101 - References
ID Reference
No reference found!
Api d 1.0101 - Protein Sequences
Source Link to source
SwissProt Q7M4I5
Api d 1.0101 - Sequence Search
Sequence Header Sequence
Api d 1.0101
SDAP Sequence ID: 975
SDAP Allergen ID: 1075
IIYPGTLWCGHGNVSSSPDELGRFKHTDSCCRSHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSSDTISSYFVGEMYFNILDTKCYKLEHPVTGCGKRTEGRCLNYTVDKSKPKVYQWFDLRKY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Expasy Blast Search
Api d 1.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Api d 1.0101 97.25 0.87 1POC_A 91.791 134 134 1 - 134 1 - 134 0 265 Download (SI: 975)
Api d 1.0101 - Alphafold Theoretical Model Structure
Model Structure
975_relaxed_rank_1_model_5.pdb


Coverage Plddt
Api d 1.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q7M4I5 Click here to process the data
Api d 1.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
975 1075 2 98 2 99 PF05826 Phospholip_A2_2 Domain CL0629 Phospholipase A2
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

Welcome

Predicted B-Cell epitope using BCEP method for Api d 1.0101

Probe radius : 1.400

POLAR area/energy = 2756.48

APOLAR area/energy = 4956.28

Total area/energy = 7712.76

Number of surface atoms = 643

Number of buried atoms = 421

Residues Predicted with high probability (in top five patches) are: 2,3,4,5,68,72,81,85,87,89,132,133,134,36,37,38,39,60,63,50,94 , and medium probability (next top five patches) are : 94,127,128,35,46,47,48,49,51,126,54,58,130,10,11,56,100,122,123,124,125 . Predicted residues are shown in red and green color stick representation.

Original PDB file 1819.test.pdb
Original PDB file with surface residue only. All amino acid residue are replaced by their CB atom, in case of GLY CA atom is used. Solvent accessible surface area of each residue is stored in last column of the PDB file. 11819.test.txt
Patch drawn around the residues by patch analysis are stored in this file
How to read: Col 1: Patch No. Col 2: Center Res Name. Col 3: Sum(Pint*Area), Col 4: Sum(Psur*Area), Col 5: Total Residue, Col 6: Interface score, Col 7: Surface Score, Col 8: Max Interface Score, Col 9: Minimum Interface Score
1819.test.tmppat
Residues predicted by patch analysis are stored in this file.
How to read: Col 1: Patch No. Col 2: Center Res Name. Col 3: Res Number Col 4: Neigbouring Res Name, Col 5: Sum(Pint*Area). Col 6: Sum(PSur*Area), Col 7: Sum(Area), Col 8: Similar no of residue in patch (e.g CYS, CYS = 2)
1819.test.res
All residues scored by patch analysis are stored in this file.
How to read: Col 1: Patch No. Col 2: Center Res Name. Col 3: Sum(Pint*Area)/sum(Area), Col 4: Sum(Psur*Area)/sum(Area), Col 5: Total Residue
1819.test.resALL

[For BCEP predicted results, please cite our websites http://fermi.utmb.edu/ http://curie.utmb.edu/ for your future publications (Negi et al., Bioinformatics, 23, 3397-3399, 2007 , Negi et al., J. Mol. Model., 13, 1157-1167, 2007; Negi et al., J. Mol. Model., 12, 921-929, 2006)]



List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids
Peptides predicted from BepiPred method can be used to search related peptides in SDAP using PD search and Cross-React method.
Please note: BepiPred Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/
Cleck here for epitopes predicted by BepiPred method

Api d 1.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2022  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.