The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 325
Allergen Scientific Name Ara h 2.0101
Allergen Species - Systematic Name Arachis hypogaea
Allergen Species - Common Name peanut
Allergen Common source foods
Allergen Common name
Allergen Keywords Conglutin
Allergen IUIS (Yes=1, No=0) 1
Ara h 2.0101 - References
ID Reference
Pubmed ID: 10474031
Kleber-Janke T, Crameri R, Appenzeller U, Schlaak M, Becker WM. Selective cloning of peanut allergens, including profilin and 2S albumins, by phage display technology. Int Arch Allergy Immunol. 1999 Aug;119(4):265-74. doi: 10.1159/000024203. PMID: 10474031
Pubmed ID: 12759484
Chatel JM, Bernard H, Orson FM. Isolation and characterization of two complete Ara h 2 isoforms cDNA. Int Arch Allergy Immunol. 2003 May;131(1):14-8. doi: 10.1159/000070429. PMID: 12759484
Pubmed ID: 9186485
Stanley JS, King N, Burks AW, Huang SK, Sampson H, Cockrell G, Helm RM, West CM, Bannon GA. Identification and mutational analysis of the immunodominant IgE binding epitopes of the major peanut allergen Ara h 2. Arch Biochem Biophys. 1997 Jun 15;342(2):244-53. doi: 10.1006/abbi.1997.9998. PMID: 9186485
Ara h 2.0101 - Protein Sequences
Source Link to source
GenBank ACN62248
GenBank 15418705
Ara h 2.0101 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
325 259 3OB4 2010-08-06 X-ray diffraction resolution 2.71 A maltose-binding protein (MBP)-Ara h 2 fusion system
3OB4.pdb


Ara h 2.0101 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
283 GetModel Model Pic Model Pic Model Pic Model Pic Click here
626 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Ara h 2.0101 - Sequence Search :
Sequence Header Sequence
Ara h 2.0101
SDAP Sequence ID: 283
SDAP Allergen ID: 325
LTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYERDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLDVESGGRDRY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ara h 2.0101
SDAP Sequence ID: 626
SDAP Allergen ID: 325
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYERDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLDVESGG
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ara h 2.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ara h 2.0101 71.3 0.6 3OB4_A 100 126 156 31 - 156 371 - 496 0 268 Download (SI: 626)
Ara h 2.0101 74.25 0.6 3OB4_A 100 130 157 28 - 157 371 - 500 0 276 Download (SI: 283)
Ara h 2.0101 - Alphafold Theoretical Model Structure
Model Structure
626_relaxed_rank_1_model_2.pdb


Coverage Plddt
Ara h 2.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
ACN62248 Click here to process the data
15418705 Click here to process the data
Ara h 2.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
283 325 42 145 42 145 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
626 325 45 148 45 148 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ara h 2.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 18-27 HASARQQWEL IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 24-31 QWELQGDR IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 30-39 DRRCQSQLER IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 42-51 LRPCEQHLMQ IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 52-59 KIQRDEDS IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 62-67 RDPYSP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 68-75 SQDPYSPS IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 120-125 LQGRQQ IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
9 130-135 KRELRNL IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
10 146-153 QRCDLDVE IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
11 62-83 RDPYSPSPYDRRGAG IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
12 31-45 RRCQSQLERANLRPC IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
13 61-75 GRDPYSPSQDPYSPS IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
14 26-40 ELQGDRRCQSQLERA IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
1 22-41 RQQWELQGDRRCQSQLERAN T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 31-51 RRCQSQLERANLRPCEQHLM T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 76-95 PYDRRGAGSSQHQERCCNEL T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 103-122 RCMCEALQQIMENQSDRLQG T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
626_relaxed_rank_1_model_2.pdb



Epitope Reference ( ID 30): I. N. Glaspole, M. P. de Leon, J. M. Rolland, and R. E. O'Hehir, Characterization of the T-cell epitopes of a major peanut allergen, Ara h 2, Allergy 2005, 60, 35-40.
A.F. Santos, N. L. Barbosa-Morais, B.K. Hurlburt, S. Ramaswamy, O. Hemmings, M. Kwok, C. O'Rourke, H. T. Bahnson, H. Cheng, L. James, H.J. Gould, B.J. Sutton, S. J. Maleki, G. Lack, IgE to epitopes of Ara h 2 enhance the diagnostic accuracy of Ara h 2-specific IgE. Allergy. 2020,Sep;75(9),2309-2318.
K. Otsu, R. Guo, S. C. Dreskin, Epitope analysis of Ara h 2 and Ara h 6: characteristic patterns of IgE-binding fingerprints among individuals with similar clinical histories. Clin Exp Allergy. 2015 Feb;45(2) , 471-84.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.