The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview

Search SDAP

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language

About SDAP
General Information
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
MMDB - Entrez
NCBI - Entrez

Protein Classification

Bioinformatics Servers
Peptide Match @ PIR
ClustalW @ EMBL - EBI

                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun ( Secure access to SDAP is available from

Allergen Info Description
Allergen ID 161
Allergen Scientific Name Asp f 13
Allergen Species - Systematic Name Aspergillus fumigatus
Allergen Species - Common Name
Allergen Common source fungi (moulds)
Allergen Common name Ascomycota Eurotiales
Allergen Keywords alkaline serine protease; Alkaline proteinase; ALP; Elastase; Elastinolytic seri
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Asp f 13 - References
ID Reference
Pubmed ID: 10677362
Chow LP, Liu SL, Yu CJ, Liao HK, Tsai JJ, Tang TK, Identification and expression of an allergen Asp f 13 from Aspergillus fumigatus and epitope mapping using human IgE antibodies and rabbit polyclonal antibodies. Biochem J. 2000 Mar 1;346 Pt 2:423-31.
Asp f 13 - Protein Sequences
Source Link to source
SwissProt P28296
Asp f 13 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
278 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Asp f 13 - Sequence Search :
Sequence Header Sequence
Asp f 13
SDAP Sequence ID: 278
SDAP Allergen ID: 161
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Asp f 13 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Asp f 13 91.3 0.72 3F7O_A 54.77 283 403 122 - 402 1 - 281 0 262 Download (SI: 278)
Asp f 13 - Alphafold Theoretical Model Structure
Model Structure

Coverage Plddt
Asp f 13 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P28296 Click here to process the data
Asp f 13 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
278 161 36 120 36 121 PF05922 Inhibitor_I9 Domain CL0570 Peptidase inhibitor I9
278 161 160 385 153 398 PF00082 Peptidase_S8 Domain No_clan Subtilase family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Asp f 13 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 286-323 NSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVD IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 289-323 ASNTSPASAPNALTVAAINKSNARASFSNYGSVVD IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 309-379 SNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 324-380 IFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIKE IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 364-403 GLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search

Epitope Reference ( ID 24): L.-P. Chow, S.-L. Liu, C.-J. Yu, H.-K. Liao, J.-J. Tsai, and T.-K. Tang, Identification and expression of an allergen Asp f 13 from Aspergillus fumigatus and epitope mapping using human IgE antibodies and rabbit polyclonal antibodies, Biochem. J. 2000, 346, 423-431.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.