The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 151
Allergen Scientific Name Asp f 3
Allergen Species - Systematic Name Aspergillus fumigatus
Allergen Species - Common Name
Allergen Common source fungi (moulds)
Allergen Common name Ascomycota Eurotiales
Allergen Keywords peroxisomal protein; Thioredoxin reductase; PMP20; Putative peroxiredoxin; EC 1.
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Asp f 3 - References
ID Reference
Pubmed ID: 12173308
Ramachandran H, Jayaraman V, Banerjee B, Greenberger PA, Kelly KJ, Fink JN, Kurup VP, IgE binding conformational epitopes of Asp f 3, a major allergen of Aspergillus fumigatus. Clin Immunol. 2002 Jun;103(3 Pt 1):324-33.
Pubmed ID: 9720820
Hemmann S, Ismail C, Blaser K, Menz G, Crameri R, Skin-test reactivity and isotype-specific immune responses to recombinant Asp f 3, a major allergen of Aspergillus fumigatus. Clin Exp Allergy. 1998 Jul;28(7):860-7.
Asp f 3 - Protein Sequences
Source Link to source
SwissProt O43099
GenBank 664852
Asp f 3 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
40 GetModel Model Pic Model Pic Model Pic Model Pic Click here
329 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Asp f 3 - Sequence Search :
Sequence Header Sequence
Asp f 3
SDAP Sequence ID: 329
SDAP Allergen ID: 151
SARDEAGLNEAVELARHAKAHILRWGNESEIYRKYFGNRPTMEAVGAYDVIVNGDKANVLFRCDNPDGNCALEGWGGHWRGANATSETVICDRSYTTRRWLVSMCSQGYTVAGSETNTFWASDLMHRLYHVPAVGQGWVDHFADGYDEVIALAKSNGTESTHDSEAFEYFALEAYAFDIAAPGVGCAGESHGPDQGHDTGSASAPASTSTSSSSSGSGSGATTTPTDSPSATIDVPSNCHTHEGGQLHCT
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Asp f 3
SDAP Sequence ID: 40
SDAP Allergen ID: 151
MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Asp f 3 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Asp f 3 95.7 0.89 5J9B_A 100 167 168 2 - 168 3 - 169 0 343 Download (SI: 40)
Asp f 3 86.45 0.72 6NJV_A 42.222 45 250 126 - 167 95 - 139 7 28.9 Download (SI: 329)
Asp f 3 - Alphafold Theoretical Model Structure
Model Structure
40_relaxed_rank_1_model_5.pdb


Coverage Plddt
Asp f 3 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
O43099 Click here to process the data
664852 Click here to process the data
Asp f 3 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
40 151 5 165 5 165 PF08534 Redoxin Domain CL0172 Redoxin
329 151 6 189 3 189 PF13933 HRXXH Domain CL0126 Putative peptidase family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Asp f 3 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 15-25 VFSYIPWSEDK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 30-50 ACGIPINYNASKEWADKKVIL IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 60-70 VCSARHVPEYI IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 85-100 AVLAYNDAYVMSAWGK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 115-125 PDARFSKSIGW IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 130-145 GRTKRYALVIDHGKIT IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 150-165 EPAKNHLEFSSAETVL IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
40_relaxed_rank_1_model_5.pdb



Epitope Reference ( ID 14): H. Ramachandran, V. Jayaraman, B. Banerjee, P. A. Greenberger, K. J. Kelly, J. N. Fink, and V. P. Kurup, IgE binding conformational epitopes of Asp f 3, a major allergen of Aspergillus fumigatus, Clin. Immun. 2002, 103, 324-333.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.