The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 337
Allergen Scientific Name Ber e 1
Allergen Species - Systematic Name Bertholletia excelsa
Allergen Species - Common Name Brazil nut
Allergen Common source foods
Allergen Common name
Allergen Keywords 2S albumin
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Ber e 1 - References
ID Reference
Pubmed ID: 9847444
astorello EA, Farioli L, Pravettoni V, Ispano M, Conti A, Ansaloni R, Rotondo F, Incorvaia C, Bengtsson A, Rivolta F, Trambaioli C, Previdi M, Ortolani C. Sensitization to the major allergen of Brazil nut is correlated with the clinical expression of allergy. J Allergy Clin Immunol. 1998 Dec;102(6 Pt 1):1021-7. doi: 10.1016/s0091-6749(98)70341-0. PMID: 9847444
Ber e 1 - Protein Sequences
Source Link to source
SwissProt P04403
GenBank 17713
GenBank 167188
Ber e 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
47 GetModel Model Pic Model Pic Model Pic Model Pic Click here
606 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Ber e 1 - Sequence Search :
Sequence Header Sequence
Ber e 1
SDAP Sequence ID: 47
SDAP Allergen ID: 337
MAKISVAAAALLVLMALGHATAFRATVTTTVVEEENQEECREQMQRQQMLSHCRMYMRQQMEESPYQTMPRRGMEPHMSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPRGEQMRRMMRLAENIPSRCNLSPMRCPMGGSIAGF
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ber e 1
SDAP Sequence ID: 606
SDAP Allergen ID: 337
MAKMSVVAAALLALLVLGQATAFRTTVTTTLEEEQEENPRGRSEQQCREQMERQQQLNHCRMYLRQQMEESPYQNPRPLRRGEEPHLDECCEQLERMDEMCRCEGLRMMLRRQREEMELQGEQMQRIMRKAENLLSRCNLSPQRCPMGGYTAWL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ber e 1
SDAP Sequence ID: 863
SDAP Allergen ID: 337
MAKISVAAAALLVLMALGHATAFRATVTTTVVEEENQEECREQMQRQQMLSHCRMYMRQQMEESPYQTMPRRGMEPHMSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPRGEQMRRMMRLAENIPSRCNLSPMRCPMGGSIAGF
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ber e 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ber e 1 72 0.57 2LVF_A 94.737 114 146 33 - 146 1 - 114 0 197 Download (SI: 47)
Ber e 1 77.15 0.64 2LVF_A 65.789 114 154 43 - 154 4 - 114 2.39e-39 130 Download (SI: 606)
Ber e 1 72 0.57 2LVF_A 94.737 114 146 33 - 146 1 - 114 0 197 Download (SI: 863)
Ber e 1 - Alphafold Theoretical Model Structure
Model Structure
863_relaxed_rank_1_model_3.pdb


Coverage Plddt
Ber e 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P04403 Click here to process the data
17713 Click here to process the data
167188 Click here to process the data
Ber e 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
47 337 40 137 40 137 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
606 337 47 145 20 145 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
863 337 40 137 40 137 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ber e 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.