The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 1105
Allergen Scientific Name Blo t 2.0104
Allergen Species - Systematic Name Blomia tropicalis
Allergen Species - Common Name mite
Allergen Common source mites
Allergen Common name
Allergen Keywords Group 2 Allergen, unknown function
Allergen IUIS (Yes=1, No=0) 1
Blo t 2.0104 - References
ID Reference
No reference found!
Blo t 2.0104 - Protein Sequences
Source Link to source
SwissProt A6XEN8
SwissProt A6XEN9
SwissProt A6XEP0
SwissProt A6XEP1
SwissProt A6XEP2
SwissProt A6XEP3
SwissProt A6XEP4
SwissProt A6XEP5
SwissProt A6XEP6
Blo t 2.0104 - Sequence Search :
Sequence Header Sequence
Blo t 2.0104
SDAP Sequence ID: 1009
SDAP Allergen ID: 1105
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEVVD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104
SDAP Sequence ID: 1010
SDAP Allergen ID: 1105
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVTTASLVGDHGVVACGKVNTEVVD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104
SDAP Sequence ID: 1011
SDAP Allergen ID: 1105
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEVVD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104
SDAP Sequence ID: 1012
SDAP Allergen ID: 1105
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEVVA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104
SDAP Sequence ID: 1013
SDAP Allergen ID: 1105
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEVFD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104
SDAP Sequence ID: 1014
SDAP Allergen ID: 1105
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTITTASLVGDHGVVACGKVNTEVVD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104
SDAP Sequence ID: 1015
SDAP Allergen ID: 1105
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSDDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEVVD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104
SDAP Sequence ID: 1016
SDAP Allergen ID: 1105
MFKFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVTTASLVGDHGVVACGKVNTEVVD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104
SDAP Sequence ID: 1017
SDAP Allergen ID: 1105
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEVID
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Blo t 2.0104 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Blo t 2.0104 89.4 0.73 1AHK_A 42.373 118 142 19 - 134 3 - 120 1.5e-29 105 Download (SI: 1011)
Blo t 2.0104 89.8 0.74 1AHK_A 42.373 118 142 19 - 134 3 - 120 1.77e-30 107 Download (SI: 1014)
Blo t 2.0104 90.2 0.74 1AHK_A 43.22 118 142 19 - 134 3 - 120 1.17e-30 108 Download (SI: 1017)
Blo t 2.0104 90.55 0.75 1AHK_A 42.373 118 142 19 - 134 3 - 120 1.78e-31 110 Download (SI: 1010)
Blo t 2.0104 88.7 0.73 1AHK_A 42.373 118 142 19 - 134 3 - 120 1.06e-29 105 Download (SI: 1015)
Blo t 2.0104 89.65 0.74 1AHK_A 43.22 118 142 19 - 134 3 - 120 1.15e-31 110 Download (SI: 1009)
Blo t 2.0104 89.6 0.74 1AHK_A 43.22 118 142 19 - 134 3 - 120 1.1e-30 108 Download (SI: 1013)
Blo t 2.0104 89.45 0.73 1AHK_A 41.525 118 142 19 - 134 3 - 120 2.57e-30 107 Download (SI: 1016)
Blo t 2.0104 90.15 0.74 1AHK_A 43.22 118 142 19 - 134 3 - 120 9.65e-31 108 Download (SI: 1012)
Blo t 2.0104 - Alphafold Theoretical Model Structure
Model Structure
1017_relaxed_rank_1_model_5.pdb


Coverage Plddt
Blo t 2.0104 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
A6XEN8 Click here to process the data
A6XEN9 Click here to process the data
A6XEP0 Click here to process the data
A6XEP1 Click here to process the data
A6XEP2 Click here to process the data
A6XEP3 Click here to process the data
A6XEP4 Click here to process the data
A6XEP5 Click here to process the data
A6XEP6 Click here to process the data
Blo t 2.0104 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1009 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
1010 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
1011 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
1012 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
1013 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
1014 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
1015 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
1016 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
1017 1105 19 139 18 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Blo t 2.0104 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.