The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 118
Allergen Scientific Name Bos d 8
Allergen Species - Systematic Name Bos domesticus
Allergen Species - Common Name domestic cattle
Allergen Common source foods
Allergen Common name
Allergen Keywords caseins from milk
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Bos d 8 - References
ID Reference
Pubmed ID: 6391289
Gjesing B, Lowenstein H, Immunochemistry of food antigens. Ann Allergy. 1984 Dec;53(6 Pt 2):602-8.
Pubmed ID: 3208764
Alexander LJ, Stewart AF, Mackinlay AG, Kapelinskaya TV, Tkach TM, Gorodetsky SI. Isolation and characterization of the bovine kappa-casein gene. Eur J Biochem. 1988 Dec 15;178(2):395-401.
Pubmed ID: 8248100
Simons G, van den Heuvel W, Reynen T, Frijters A, Rutten G, Slangen CJ, Groenen M, de Vos WM, Siezen RJ. Overproduction of bovine beta-casein in Escherichia coli and engineering of its main chymosin cleavage site. Protein Eng. 1993 Sep;6(7):763-70.
Pubmed ID: 2833669
Stewart AF, Bonsing J, Beattie CW, Shah F, Willis IM, Mackinlay AG. Complete nucleotide sequences of bovine alpha S2- and beta-casein cDNAs: comparisons with related sequences in other species. Mol Biol Evol. 1987 May;4(3):231-41.
Pubmed ID: 6689612
Gorodetskii SI, Kershulite DR, Korobko VG. [Primary structure of cDNA of Bos taurus kappa-casein macropeptide] Bioorg Khim. 1983 Dec;9(12):1693-5. Russian.
Pubmed ID: 3271384
onsing J, Ring JM, Stewart AF, Mackinlay AG. Complete nucleotide sequence of the bovine beta-casein gene. Aust J Biol Sci. 1988;41(4):527-37.
Pubmed ID: 3814153
Jimenez-Flores R, Kang YC, Richardson T. Cloning and sequence analysis of bovine beta-casein cDNA. Biochem Biophys Res Commun. 1987 Jan 30;142(2):617-21.
Bos d 8 - Protein Sequences
Source Link to source
GenBank 92
GenBank 162794
GenBank 162650
GenBank 162927
GenBank 162929
GenBank 162797
GenBank 162805
GenBank 162807
GenBank 162811
GenBank 162931
GenBank 459292
GenBank 1228078
GenBank 162935
Bos d 8 - Sequence Search :
Sequence Header Sequence
Bos d 8
SDAP Sequence ID: 565
SDAP Allergen ID: 118
MKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSEKTTMPLW
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 566
SDAP Allergen ID: 118
MKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVALFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIDAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSEKTTISLW
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 567
SDAP Allergen ID: 118
PQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGLENSEKTTMPLW
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 568
SDAP Allergen ID: 118
LSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKQIQKEDVPSERYLGYLEQLLRLKKYKVPQLEIVPNS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 569
SDAP Allergen ID: 118
MKFFIFTCLLAVALAKNTMEHVSSSEESIISQETYKQEKNMAINPSKENLCSTFCKEVVRNANEEEYSIGSSSEESAEVATEEVKITVDDKHYQKALNEINQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNREQLSTSEENSKKTVDMESTEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 570
SDAP Allergen ID: 118
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVLGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPPLLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQQPVLGPVRGPFPIIV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 571
SDAP Allergen ID: 118
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIHNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 572
SDAP Allergen ID: 118
AQILQWQVLSNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVTESPPEINTVQVTSTAV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 573
SDAP Allergen ID: 118
MMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVTESPPEINTVQVTSTAV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 574
SDAP Allergen ID: 118
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 575
SDAP Allergen ID: 118
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKQKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 576
SDAP Allergen ID: 118
MMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8
SDAP Sequence ID: 577
SDAP Allergen ID: 118
RCEKDERFFSDKXAK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 8 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Bos d 8 58 0.16 5AXH_A 31.373 51 224 125 - 170 148 - 198 0.12 34.7 Download (SI: 570)
Bos d 8 55.75 0.14 6KCX_A 33.333 36 93 20 - 55 402 - 437 1.5 28.5 Download (SI: 567)
Bos d 8 58.8 0.16 4NLB_A 29.204 113 224 97 - 208 134 - 228 0.73 32 Download (SI: 575)
Bos d 8 64.55 0.15 3W4R_A 22.368 76 99 30 - 98 394 - 469 4.2 27.3 Download (SI: 572)
Bos d 8 55.1 0.22 6FS5_A 100 39 222 165 - 203 1 - 39 1.45e-19 79.7 Download (SI: 569)
Bos d 8 58.35 0.16 6EPC_Z 28.571 91 224 32 - 119 28 - 115 1.5 31.2 Download (SI: 574)
Bos d 8 48.4 0.22 7AYV_A 28.155 103 214 42 - 138 92 - 184 1.2 31.6 Download (SI: 566)
Bos d 8 53.4 0.15 4AWS_A 34.884 43 190 82 - 122 68 - 110 1.8 30.4 Download (SI: 576)
Bos d 8 68.3 0.27 6POJ_A 41.379 29 76 21 - 49 255 - 283 0.73 28.9 Download (SI: 568)
Bos d 8 58.45 0.16 6EPC_Z 28.571 91 224 32 - 119 28 - 115 1.4 31.6 Download (SI: 571)
Bos d 8 49.6 0.22 7AYV_A 28.431 102 214 43 - 138 93 - 184 1.5 31.2 Download (SI: 565)
Bos d 8 53.55 0.15 4AWS_A 34.884 43 190 82 - 122 68 - 110 1.9 30.4 Download (SI: 573)
Bos d 8 - Alphafold Theoretical Model Structure
Model Structure
577_relaxed_rank_1_model_1.pdb


Coverage Plddt
Bos d 8 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
92 Click here to process the data
162794 Click here to process the data
162650 Click here to process the data
162927 Click here to process the data
162929 Click here to process the data
162797 Click here to process the data
162805 Click here to process the data
162807 Click here to process the data
162811 Click here to process the data
162931 Click here to process the data
459292 Click here to process the data
1228078 Click here to process the data
162935 Click here to process the data
Bos d 8 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
565 118 112 203 112 204 PF00363 Casein Family No_clan Casein
566 118 112 203 112 204 PF00363 Casein Family No_clan Casein
567 118 1 81 1 83 PF00363 Casein Family No_clan Casein
569 118 140 210 135 211 PF00363 Casein Family No_clan Casein
570 118 138 217 138 219 PF00363 Casein Family No_clan Casein
571 118 138 217 138 219 PF00363 Casein Family No_clan Casein
572 118 1 97 1 98 PF00997 Casein_kappa Family No_clan Kappa casein
573 118 22 188 22 189 PF00997 Casein_kappa Family No_clan Kappa casein
574 118 138 217 138 219 PF00363 Casein Family No_clan Casein
575 118 138 217 138 219 PF00363 Casein Family No_clan Casein
576 118 22 188 22 189 PF00997 Casein_kappa Family No_clan Kappa casein
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Bos d 8 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.