The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 332
Allergen Scientific Name Cap a 1w
Allergen Species - Systematic Name Capsicum annuum
Allergen Species - Common Name bell pepper
Allergen Common source foods
Allergen Common name
Allergen Keywords osmotin-like protein; homolog: pathogenesis related protein PR5: Actinidin
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Cap a 1w - References
ID Reference
Pubmed ID: 14705920
Ivanciuc O, Mathura V, Midoro-Horiuti T, Braun W, Goldblum RM, Schein CH Detecting potential IgE-reactive sites on food proteins using a sequence and structure database, SDAP-food. J Agric Food Chem. 2003 Jul 30;51(16):4830-7.
Cap a 1w - Protein Sequences
Source Link to source
GenBank 11321159
GenBank 16609959
Cap a 1w - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
281 GetModel Model Pic Model Pic Model Pic Model Pic Click here
375 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Cap a 1w - Sequence Search :
Sequence Header Sequence
Cap a 1w
SDAP Sequence ID: 281
SDAP Allergen ID: 332
NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCVANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDP
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Cap a 1w
SDAP Sequence ID: 375
SDAP Allergen ID: 332
MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPGSDGVAK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Cap a 1w - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Cap a 1 97.5 0.84 1AUN_A 97.222 180 180 1 - 180 8 - 187 0 359 Download (SI: 281)
Cap a 1w 90.1 0.79 2I0W_A 90.338 207 246 22 - 228 1 - 207 0 391 Download (SI: 375)
Cap a 1w - Alphafold Theoretical Model Structure
Model Structure
375_relaxed_rank_1_model_3.pdb


Coverage Plddt
Cap a 1w - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
11321159 Click here to process the data
16609959 Click here to process the data
Cap a 1w - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
281 332 1 179 1 180 PF00314 Thaumatin Domain CL0293 Thaumatin family
375 332 28 226 28 226 PF00314 Thaumatin Domain CL0293 Thaumatin family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Cap a 1w - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.