The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 47
Allergen Scientific Name Car b 1
Allergen Species - Systematic Name Carpinus betulus
Allergen Species - Common Name hornbeam
Allergen Common source tree
Allergen Common name Fagales
Allergen Keywords homolog: pathogenesis related protein PR10
Allergen IUIS (Yes=1, No=0) 1

Car b 1 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Car b 1.0101
2 Car b 1.0102
3 Car b 1.0103
4 Car b 1.0104
5 Car b 1.0105
6 Car b 1.0106
7 Car b 1.0106
8 Car b 1.0106
9 Car b 1.0106
10 Car b 1.0107
11 Car b 1.0107
12 Car b 1.0108
13 Car b 1.0201
14 Car b 1.0301
15 Car b 1.0302
16 Car b 1.0109
17 Car b 1.0110
18 Car b 1.0111
19 Car b 1.0112
20 Car b 1.0113
Car b 1 - References
ID Reference
Pubmed ID: 1603091
Larsen JN, Stroman P, Ipsen H. PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betulus, hornbeam. Mol Immunol. 1992 Jun;29(6):703-11.
Car b 1 - Protein Sequences
Source Link to source
SwissProt P38949
SwissProt P38950
Car b 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
84 GetModel Model Pic Model Pic Model Pic Model Pic Click here
85 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Car b 1 - Sequence Search :
Sequence Header Sequence
Car b 1
SDAP Sequence ID: 84
SDAP Allergen ID: 47
GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Car b 1
SDAP Sequence ID: 85
SDAP Allergen ID: 47
GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Car b 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Car b 1 93.6 0.82 1LLT_A 72.956 159 159 1 - 159 1 - 159 0 244 Download (SI: 84)
Car b 1 93.6 0.82 4A84_A 75.472 159 159 1 - 159 1 - 159 0 253 Download (SI: 85)
Car b 1 - Alphafold Theoretical Model Structure
Model Structure
85_relaxed_rank_1_model_2.pdb


Coverage Plddt
Car b 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P38949 Click here to process the data
P38950 Click here to process the data
Car b 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
84 47 2 154 1 154 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
85 47 2 154 1 154 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Car b 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.