The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 673
Allergen Scientific Name Car p 1
Allergen Species - Systematic Name Carica papaya
Allergen Species - Common Name papaya
Allergen Common source foods
Allergen Common name
Allergen Keywords papain
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Car p 1 - References
ID Reference
Pubmed ID: 7039863
Baur X, Konig G, Bencze K, Fruhmann G. Clinical symptoms and results of skin test, RAST and bronchial provocation test in thirty-three papain workers: evidence for strong immunogenic potency and clinically relevant 'proteolytic effects of airborne papain'. Clin Allergy. 1982 Jan;12(1):9-17.
Pubmed ID: 421337
Baur X, Fruhmann G. Papain-induced asthma: diagnosis by skin test, RAST and bronchial provocation test. Clin Allergy. 1979 Jan;9(1):75-81.
Car p 1 - Protein Sequences
Source Link to source
GenBank 167391
Car p 1 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
673 185 1KHQ 30-NOV-01 X-ray diffraction resolution 1.60 A ORTHORHOMBIC FORM OF PAPAIN/ZLFG-DAM COVALENT COMPLEX
673 186 1PPN 25-OCT-91 X-ray diffraction resolution 1.60 A PAPAIN CYS-25 WITH BOUND ATOM
673 275 2CIO 2006-03-24 X-ray diffraction resolution 1.50 A complex with cysteine protease inhibitor fragment from Trypanosoma brucei
673 276 3E1Z 2008-08-05 X-ray diffraction resolution 1.86 A complex with parasite protesase inhibitor chagasin
673 277 3IMA 2009-08-10 X-ray diffraction resolution 2.03 A complex with tarocystatin
3IMA.pdb


Car p 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
623 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Car p 1 - Sequence Search :
Sequence Header Sequence
Car p 1
SDAP Sequence ID: 623
SDAP Allergen ID: 673
MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Car p 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Car p papain 91.65 0.81 3TNX_A 98.746 319 345 27 - 345 45 - 363 0 655 Download (SI: 623)
Car p 1 - Alphafold Theoretical Model Structure
Model Structure
623_relaxed_rank_1_model_3.pdb


Coverage Plddt
Car p 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
167391 Click here to process the data
Car p 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
623 673 48 104 48 104 PF08246 Inhibitor_I29 Domain No_clan Cathepsin propeptide inhibitor domain (I29)
623 673 134 342 134 343 PF00112 Peptidase_C1 Domain CL0125 Papain family cysteine protease
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Car p 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.