The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 68
Allergen Scientific Name Cup a 1
Allergen Species - Systematic Name Cupressus arizonica
Allergen Species - Common Name cypress
Allergen Common source tree
Allergen Common name Pinales
Allergen Keywords Cha o 1 homologue
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Cup a 1 - References
ID Reference
Pubmed ID: 11122214
Aceituno E, Del Pozo V, Minguez A, Arrieta I, Cortegano I, Cardaba B, Gallardo S, Rojo M, Palomino P, Lahoz C. Molecular cloning of major allergen from Cupressus arizonica pollen: Cup a 1. Clin Exp Allergy. 2000 Dec;30(12):1750-8.
Pubmed ID: 15051935
Arilla MC, Ibarrola I, Garcia R, de la Hoz B, Martinez A, Asturias JA. Quantification of the major allergen from cypress (Cupressus arizonica) pollen, Cup a 1, by monoclonal antibody-based ELISA. Int Arch Allergy Immunol. 2004 May;134(1):10-6. Epub 2004 Mar 25.
Pubmed ID: 15358365
Rea G, Iacovacci P, Ferrante P, Zelli M, Brunetto B, Lamba D, Boffi A, Pini C, Federico R. Refolding of the Cupressus arizonica major pollen allergen Cup a1.02 overexpressed in Escherichia coli. Protein Expr Purif. 2004 Oct;37(2):419-25.
Pubmed ID: 11576077
Alisi C, Afferni C, Iacovacci P, Barletta B, Tinghino R, Butteroni C, Puggioni EM, Wilson IB, Federico R, Schinina ME, Ariano R, Di Felice G, Pini C. Rapid isolation, characterization, and glycan analysis of Cup a 1, the major allergen of Arizona cypress (Cupressus arizonica) pollen. Allergy. 2001 Oct;56(10):978-84.
Pubmed ID: 12569984
Iacovacci P, Afferni C, Butteroni C, Pironi L, Puggioni EM, Orlandi A, Barletta B, Tinghino R, Ariano R, Panzani RC, Di Felice G, Pini C. Comparison between the native glycosylated and the recombinant Cup a1 allergen: role of carbohydrates in the histamine release from basophils. Clin Exp Allergy. 2002 Nov;32(11):1620-7.
Cup a 1 - Protein Sequences
Source Link to source
SwissProt Q9SCG9
GenBank 19069497
Cup a 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
100 GetModel Model Pic Model Pic Model Pic Model Pic Click here
775 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Cup a 1 - Sequence Search :
Sequence Header Sequence
Cup a 1
SDAP Sequence ID: 100
SDAP Allergen ID: 68
DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Cup a 1
SDAP Sequence ID: 775
SDAP Allergen ID: 68
MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Cup a 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Cup a 1 94.35 0.85 1PXZ_A 95.087 346 367 22 - 367 1 - 346 0 687 Download (SI: 775)
Cup a 1 97.25 0.88 1PXZ_A 94.783 345 346 1 - 345 1 - 345 0 687 Download (SI: 100)
Cup a 1 - Alphafold Theoretical Model Structure
Model Structure
775_relaxed_rank_1_model_1.pdb


Coverage Plddt
Cup a 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q9SCG9 Click here to process the data
19069497 Click here to process the data
Cup a 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
100 68 91 268 73 268 PF00544 Pectate_lyase_4 Repeat CL0268 Pectate lyase
775 68 109 289 94 289 PF00544 Pectate_lyase_4 Repeat CL0268 Pectate lyase
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Cup a 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.