The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 20
Allergen Scientific Name Dac g 2
Allergen Species - Systematic Name Dactylis glomerata
Allergen Species - Common Name orchard grass
Allergen Common source grass
Allergen Common name Poales
Allergen Keywords beta-galactosidase fusion protein; Dac g II
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Dac g 2 - References
ID Reference
Pubmed ID: 8116860
Roberts AM, Bevan LJ, Flora PS, Jepson I, Walker MR, Nucleotide sequence of cDNA encoding the group II allergen of cocksfoot/orchard grass (Dactylis glomerata), Dac g II. Allergy. 1993 Nov;48(8):615-23.
Dac g 2 - Protein Sequences
Source Link to source
SwissProt Q41183
GenBank 255657
GenBank 4007040
Dac g 2 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
104 GetModel Model Pic Model Pic Model Pic Model Pic Click here
794 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Dac g 2 - Sequence Search :
Sequence Header Sequence
Dac g 2
SDAP Sequence ID: 104
SDAP Allergen ID: 20
EAPVTFTVEKGSDEKNLALSIKYNKEGDSMAEVELK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Dac g 2
SDAP Sequence ID: 301
SDAP Allergen ID: 20
EAPVTFTVEKGSDEKNLALSIKYNKE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Dac g 2
SDAP Sequence ID: 794
SDAP Allergen ID: 20
MSMASSSSSGLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Dac g 2 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Dac g 2 87.15 0.44 3FT1_A 69.697 33 36 4 - 36 4 - 36 0.000000000234 51.2 Download (SI: 104)
Dac g 2 87.3 0.73 1BMW_A 100 96 122 27 - 122 1 - 96 0 199 Download (SI: 794)
Dac g 2 88.55 0.35 3FT1_A 68.182 22 26 4 - 25 4 - 25 0.000488 34.3 Download (SI: 301)
Dac g 2 - Alphafold Theoretical Model Structure
Model Structure
794_relaxed_rank_1_model_2.pdb


Coverage Plddt
Dac g 2 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q41183 Click here to process the data
255657 Click here to process the data
4007040 Click here to process the data
Dac g 2 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
794 20 30 109 30 109 PF01357 Expansin_C Domain CL0159 Expansin C-terminal domain
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Dac g 2 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.