The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 83
Allergen Scientific Name Der f 2
Allergen Species - Systematic Name Dermatophagoides farinae
Allergen Species - Common Name American house dust mite
Allergen Common source mites
Allergen Common name
Allergen Keywords NPC2 family
Allergen IUIS (Yes=1, No=0) 1

Der f 2 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Der f 2.0101
2 Der f 2.0102
3 Der f 2.0103
4 Der f 2.0104
5 Der f 2.0105
6 Der f 2.0106
7 Der f 2.0107
8 Der f 2.0108
9 Der f 2.0109
10 Der f 2.0110
11 Der f 2.0111
12 Der f 2.0112
13 Der f 2.0113
14 Der f 2.0114
15 Der f 2.0115
16 Der f 2.0116
17 Der f 2.0117
Der f 2 - References
ID Reference
Pubmed ID: 8508052
Nishiyama C, Yuuki T, Takai T, Okumura Y, Okudaira H, Determination of three disulfide bonds in a major house dust mite allergen, Der f II. Int Arch Allergy Immunol. 1993;101(2):159-66.
Pubmed ID: 9255789
Takai T, Yokota T, Yasue M, Nishiyama C, Yuuki T, Mori A, Okudaira H, Okumura Y, Comment in: Nat Biotechnol. 1997 Aug;15(8):718-9. Engineering of the major house dust mite allergen Der f 2 for allergen-specific immunotherapy. Nat Biotechnol. 1997 Aug;15(8):754-8.
Pubmed ID: 2021876
Trudinger M, Chua KY, Thomas WR, cDNA encoding the major mite allergen Der f II. Clin Exp Allergy. 1991 Jan;21(1):33-7.
Der f 2 - Protein Sequences
Source Link to source
SwissProt Q00855
GenBank 217304
GenBank 217308
GenBank 13560629
Der f 2 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
83 4 1AHK 07-APR-97 NMR, minimized average structure
83 5 1AHM 07-APR-97 NMR, 10 structures
83 182 1XWV 02-NOV-04 X-ray diffraction resolution 1.83 A
83 192 1WRF 15-OCT-04 NMR, 11 structures
83 287 2F08 2005-11-12 X-ray diffraction resolution 2.20 A
2F08.pdb


Der f 2 - Sequence Search :
Sequence Header Sequence
Der f 2
SDAP Sequence ID: 109
SDAP Allergen ID: 83
MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Der f 2
SDAP Sequence ID: 785
SDAP Allergen ID: 83
SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Der f 2
SDAP Sequence ID: 786
SDAP Allergen ID: 83
SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLACAIATHAKIRD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Der f 2
SDAP Sequence ID: 787
SDAP Allergen ID: 83
LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Der f 2 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Der f 2 94.9 0.83 1AHK_A 100 129 138 10 - 138 1 - 129 0 265 Download (SI: 785)
Der f 2 94.2 0.82 1XWV_A 100 129 138 10 - 138 1 - 129 0 267 Download (SI: 786)
Der f 2 91.3 0.76 1AHK_A 99.225 129 146 18 - 146 1 - 129 0 265 Download (SI: 109)
Der f 2 72.55 0.61 1AHK_A 81.013 158 170 13 - 170 1 - 129 0 249 Download (SI: 787)
Der f 2 - Alphafold Theoretical Model Structure
Model Structure
787_relaxed_rank_1_model_2.pdb


Coverage Plddt
Der f 2 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q00855 Click here to process the data
217304 Click here to process the data
217308 Click here to process the data
13560629 Click here to process the data
Der f 2 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
109 83 20 137 19 140 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
785 83 12 129 11 132 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
786 83 12 129 11 134 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
787 83 53 161 50 164 PF02221 E1_DerP2_DerF2 Domain CL0532 ML domain
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Der f 2 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.