The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 93
Allergen Scientific Name Der p 1
Allergen Species - Systematic Name Dermatophagoides pteronyssinus
Allergen Species - Common Name European house dust mite
Allergen Common source mites
Allergen Common name
Allergen Keywords antigen P1, cysteine protease; EC 3.4.22
Allergen IUIS (Yes=1, No=0) 1

Der p 1 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Der p 1.0101
2 Der p 1.0102
3 Der p 1.0103
4 Der p 1.0104
5 Der p 1.0105
6 Der p 1.0106
7 Der p 1.0107
8 Der p 1.0108
9 Der p 1.0109
10 Der p 1.0110
11 Der p 1.0111
12 Der p 1.0112
13 Der p 1.0113
14 Der p 1.0114
15 Der p 1.0115
16 Der p 1.0116
17 Der p 1.0117
18 Der p 1.0118
19 Der p 1.0119
20 Der p 1.0120
21 Der p 1.0121
22 Der p 1.0122
23 Der p 1.0123
24 Der p 1.0124
Der p 1 - References
ID Reference
Pubmed ID: 3335830
Chua KY, Stewart GA, Thomas WR, Simpson RJ, Dilworth RJ, Plozza TM, Turner KJ, Sequence analysis of cDNA coding for a major house dust mite allergen, Der p 1. Homology with cysteine proteases. J Exp Med. 1988 Jan 1;167(1):175-82.
Pubmed ID: 3276629
Thomas WR, Stewart GA, Simpson RJ, Chua KY, Plozza TM, Dilworth RJ, Nisbet A, Turner KJ, Cloning and expression of DNA coding for the major house dust mite allergen Der p 1 in Escherichia coli. Int Arch Allergy Appl Immunol. 1988;85(1):127-9.
Der p 1 - Protein Sequences
Source Link to source
SwissProt P08176
GenBank 387592
Der p 1 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
93 193 1XKG 29-SEP-04 X-ray diffraction resolution 1.61 A
93 213 3F5V 2008-11-04 X-ray diffraction resolution 1.36 A
93 285 2AS8 2005-08-23 X-ray diffraction resolution 1.95 A
2AS8.pdb


Der p 1 - Sequence Search :
Sequence Header Sequence
Der p 1
SDAP Sequence ID: 114
SDAP Allergen ID: 93
MKIVLAIASLLALSAVYARPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Der p 1
SDAP Sequence ID: 790
SDAP Allergen ID: 93
MSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLDLAEQELVDCASQHGCHGDTIPR
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Der p 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Der p 1 93.85 0.84 1XKG_A 99.007 302 320 19 - 320 1 - 302 0 630 Download (SI: 114)
Der p 1 90.25 0.77 1XKG_A 96.875 96 96 1 - 96 63 - 158 0 199 Download (SI: 790)
Der p 1 - Alphafold Theoretical Model Structure
Model Structure
790_relaxed_rank_1_model_2.pdb


Coverage Plddt
Der p 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P08176 Click here to process the data
387592 Click here to process the data
Der p 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
114 93 109 315 108 319 PF00112 Peptidase_C1 Domain CL0125 Papain family cysteine protease
790 93 29 93 28 96 PF00112 Peptidase_C1 Domain CL0125 Papain family cysteine protease
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Der p 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.