The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 683
Allergen Scientific Name Gly m TI
Allergen Species - Systematic Name Glycine max
Allergen Species - Common Name soybean
Allergen Common source foods
Allergen Common name
Allergen Keywords Kunitz trypsin inhibitor
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Gly m TI - References
ID Reference
No reference found!
Gly m TI - Protein Sequences
Source Link to source
GenBank 510515
GenBank 18770
GenBank 18772
GenBank 256635
GenBank 256636
GenBank 256429
SwissProt P01071
Gly m TI - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
678 GetModel Model Pic Model Pic Model Pic Model Pic Click here
679 GetModel Model Pic Model Pic Model Pic Model Pic Click here
680 GetModel Model Pic Model Pic Model Pic Model Pic Click here
681 GetModel Model Pic Model Pic Model Pic Model Pic Click here
682 GetModel Model Pic Model Pic Model Pic Model Pic Click here
683 GetModel Model Pic Model Pic Model Pic Model Pic Click here
818 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Gly m TI - Sequence Search :
Sequence Header Sequence
Gly m TI
SDAP Sequence ID: 678
SDAP Allergen ID: 683
MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTETETCPLTVVQSPFEGLQRGLPLIISSPFKILDITEGLILSLKFHLCTPLSLNSFSVDRYSQGSARRTPCQTHWLQKHNRCWFRIQRASSESNYYKLVFCTSNDDSSCGDIVAPIDREGNRPLIVTHDQNHPLLVQFQKVEAYESSTA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gly m TI
SDAP Sequence ID: 679
SDAP Allergen ID: 683
MKSTIFFALFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gly m TI
SDAP Sequence ID: 680
SDAP Allergen ID: 683
MKSTIFFALFLFCAFTTSYLPSAIADFVLDNEGNPLDSGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRIERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKESLAKKNHGLSRSE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gly m TI
SDAP Sequence ID: 681
SDAP Allergen ID: 683
MKSTIFFALFLVCAFTISYLPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKGGGIEVDSTGKEICPLTVVQSPNELDKGIGLVFTSPLHALFIAERYPLSIKFGSFAVITLCAGMPTEWAIVEREGLQAVKLAARDTVDGWFNIERVSREYNDYKLVFCPQQAEDNKCEDIGIQIDDDGIRRLVLSKNKPLVVQFQKFRSSTA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gly m TI
SDAP Sequence ID: 682
SDAP Allergen ID: 683
MKSTIFFALFLVCAFTISYLPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKSGGIEGNSTGKEICPLTVVQSPNKHNKGIGLVFKSPLHALFIAERYPLSIKFDSFAVIPLCGVMPTKWAIVEREGLQAVTLAARDTVDGWFNIERVSREYNDYYKLVFCPQEAEDNKCEDIGIQIDNDGIRRLVLSKNKPLVVEFQKFRSSTA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gly m TI
SDAP Sequence ID: 683
SDAP Allergen ID: 683
MKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gly m TI
SDAP Sequence ID: 818
SDAP Allergen ID: 683
DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRIERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKESL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gly m TI - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Gly m TI 75.35 0.67 6NTT_A 47.143 210 208 1 - 201 1 - 201 5.60519e-45 149 Download (SI: 678)
Gly m TI 93.15 0.83 6NTT_A 95.58 181 181 1 - 181 25 - 205 0 360 Download (SI: 818)
Gly m TI 88.4 0.76 6NTT_A 61.386 202 204 1 - 199 1 - 200 0 235 Download (SI: 682)
Gly m TI 87 0.75 6NTT_A 100 216 216 1 - 216 1 - 216 0 446 Download (SI: 683)
Gly m TI 89.65 0.77 6NTT_A 66.995 203 203 1 - 198 1 - 200 0 253 Download (SI: 681)
Gly m TI 86.7 0.74 6NTT_A 95.392 217 217 1 - 217 1 - 216 0 426 Download (SI: 680)
Gly m TI 86.9 0.74 6NTT_A 99.539 217 217 1 - 217 1 - 216 0 442 Download (SI: 679)
Gly m TI - Alphafold Theoretical Model Structure
Model Structure
818_relaxed_rank_1_model_1.pdb


Coverage Plddt
Gly m TI - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
510515 Click here to process the data
18770 Click here to process the data
18772 Click here to process the data
256635 Click here to process the data
256636 Click here to process the data
256429 Click here to process the data
P01071 Click here to process the data
Gly m TI - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
678 683 28 199 28 199 PF00197 Kunitz_legume Domain CL0066 Trypsin and protease inhibitor
679 683 28 200 28 200 PF00197 Kunitz_legume Domain CL0066 Trypsin and protease inhibitor
680 683 28 200 28 200 PF00197 Kunitz_legume Domain CL0066 Trypsin and protease inhibitor
681 683 28 197 28 197 PF00197 Kunitz_legume Domain CL0066 Trypsin and protease inhibitor
682 683 28 198 28 198 PF00197 Kunitz_legume Domain CL0066 Trypsin and protease inhibitor
683 683 27 199 27 199 PF00197 Kunitz_legume Domain CL0066 Trypsin and protease inhibitor
818 683 3 175 3 175 PF00197 Kunitz_legume Domain CL0066 Trypsin and protease inhibitor
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Gly m TI - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.