The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 350
Allergen Scientific Name Hev b 3
Allergen Species - Systematic Name Hevea brasiliensis
Allergen Species - Common Name rubber (latex)
Allergen Common source others
Allergen Common name
Allergen Keywords SRPP; 22 kDa rubber particle protein; 22 kDa RPP; 27 kDa natural rubber
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Hev b 3 - References
ID Reference
Pubmed ID: 8400886
Alenius H, Palosuo T, Kelly K, Kurup V, Reunala T, Makinen-Kiljunen S, Turjanmaa K, Fink J. IgE reactivity to 14-kD and 27-kD natural rubber proteins in latex-allergic children with spina bifida and other congenital anomalies. Int Arch Allergy Immunol. 1993;102(1):61-6.
Pubmed ID: 8828541
Yeang HY, Cheong KF, Sunderasan E, Hamzah S, Chew NP, Hamid S, Hamilton RG, Cardosa MJ. The 14.6 kd rubber elongation factor (Hev b 1) and 24 kd (Hev b 3) rubber particle proteins are recognized by IgE from patients with spina bifida and latex allergy. J Allergy Clin Immunol. 1996 Sep;98(3):628-39.
Pubmed ID: 10550757
Wagner B, Krebitz M, Buck D, Niggemann B, Yeang HY, Han KH, Scheiner O, Breiteneder H. Cloning, expression, and characterization of recombinant Hev b 3, a Hevea brasiliensis protein associated with latex allergy in patients with spina bifida. J Allergy Clin Immunol. 1999 Nov;104(5):1084-92.
Pubmed ID: 9636811
Yeang HY, Ward MA, Zamri AS, Dennis MS, Light DR. Amino acid sequence similarity of Hev b 3 to two previously reported 27- and 23-kDa latex proteins allergenic to spina bifida patients. Allergy. 1998 May;53(5):513-9.
Pubmed ID: 11275264
Banerjee B, Kanitpong K, Fink JN, Zussman M, Sussman GL, Kelly KJ, Kurup VP, Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy. Mol Immunol. 2000 Aug-Sep;37(12-13):789-98.
Hev b 3 - Protein Sequences
Source Link to source
SwissProt O82803
Hev b 3 - Sequence Search :
Sequence Header Sequence
Hev b 3
SDAP Sequence ID: 151
SDAP Allergen ID: 350
MAEEVEEERLKYLDFVRAAGVYAVDSFSTLYLYAKDISGPLKPGVDTIENVVKTVVTPVYYIPLEAVKFVDKTVDVSVTSLDGVVPPVIKQVSAQTYSVAQDAPRIVLDVASSVFNTGVQEGAKALYANLEPKAEQYAVITWRALNKLPLVPQVANVVVPTAVYFSEKYNDVVRGTTEQGYRVSSYLPLLPTEKITKVFGDEAS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hev b 3 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Hev b 3 71.4 0.42 2F9Y_A 21.429 140 204 42 - 160 139 - 276 4.2 29.6 Download (SI: 151)
Hev b 3 - Alphafold Theoretical Model Structure
Model Structure
151_relaxed_rank_1_model_4.pdb


Coverage Plddt
Hev b 3 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
O82803 Click here to process the data
Hev b 3 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
151 350 5 200 4 201 PF05755 REF Family No_clan Rubber elongation factor protein (REF)
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Hev b 3 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 2-11 AEEVEEERLK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 8-17 ERLKYLDFVR IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 29-38 TLYLYAKDIS IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 41-50 LKPGVDTIEN IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 60-69 YYIPLEAVKFV IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 85-94 VPPVIKQVSA IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 103-112 APRIVLDVAS IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 118-127 GVQEGAKALY IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
9 138-147 AVITWRALNK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
10 159-168 VPTAVYFSEK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
11 179-188 QGYRVSSYLP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
151_relaxed_rank_1_model_4.pdb



Epitope Reference ( ID 6): B. Banerjee, K. Kanitpong, J. N. Fink, M. Zussman, G. L. Sussman, K. J. Kelly, and V. P. Kurup, Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy, Mol. Immunol. 2000, 37, 789-798.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.