The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 352
Allergen Scientific Name Hev b 5
Allergen Species - Systematic Name Hevea brasiliensis
Allergen Species - Common Name rubber (latex)
Allergen Common source others
Allergen Common name
Allergen Keywords kiwi and potato homologue
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Hev b 5 - References
ID Reference
Pubmed ID: 8810306
Slater JE, Vedvick T, Arthur-Smith A, Trybul DE, Kekwick RG. Identification, cloning, and sequence of a major allergen (Hev b 5) from natural rubber latex (Hevea brasiliensis). J Biol Chem. 1996 Oct 11;271(41):25394-9.
Hev b 5 - Protein Sequences
Source Link to source
SwissProt Q39967
GenBank 1480457
Hev b 5 - Sequence Search :
Sequence Header Sequence
Hev b 5
SDAP Sequence ID: 152
SDAP Allergen ID: 352
ASVEVESAATALPKNETPEVTKAEETKTEEPAAPPASEQETADATPEKEEPTAAPAEPEAPAPETEKAEEVEKIEKTEEPAPEADQTTPEEKPAEPEPVAEEEPKHETKETETEAPAAPAEGEKPAEEEKPITEAAETATTEVPVEKTEE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hev b 5
SDAP Sequence ID: 386
SDAP Allergen ID: 352
MASVEVESAATALPKNETPEVTKAEETKTEEPAAPPASEQETADATPEKEEPTAAPAEPEAPAPETEKAEEVEKIEKTEEPAPEADQTTPEEKPAEPEPVAEEEPKHETKETETEAPAAPAEGEKPAEEEKPITEAAETATTEVPVEKTEE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hev b 5 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Hev b 5 55.25 0.12 2PO3_A 30.769 65 150 3 - 67 301 - 353 0.25 32.3 Download (SI: 152)
Hev b 5 54.4 0.1 2PO3_A 30.769 65 151 4 - 68 301 - 353 0.27 32.3 Download (SI: 386)
Hev b 5 - Alphafold Theoretical Model Structure
Model Structure
386_relaxed_rank_1_model_2.pdb


Coverage Plddt
Hev b 5 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q39967 Click here to process the data
1480457 Click here to process the data
Hev b 5 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Hev b 5 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 15-22 KNETPEVT IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 27-34 TKTEEPAA IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 34-43 APPASEQET IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 50-59 EEPTAAPAEP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 67-74 EKAEEVEK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 75-82 IEKTEEPA IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 86-98 DQTTPEEKPAEPE IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 103-111 EEPKHETKE IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
9 124-132 EKPAEEEKP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
10 132-139 PITEAAET IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
11 142-149 TEVPVEKT IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
386_relaxed_rank_1_model_2.pdb



Epitope Reference ( ID 15): D. H. Beezhold, V. L. Hickey, and G. L. Sussman, Mutational analysis of the IgE epitopes in the latex allergen Hev b 5, J. Allergy Clin. Immunol. 2001, 107, 1069-1076.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.